KEGG   Rivularia sp. PCC 7116: Riv7116_0388Help
Entry
Riv7116_0388      CDS       T02364                                 

Definition
putative bile acid beta-glucosidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Riv7116_0388
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Riv7116_0388
Enzymes [BR:riv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Riv7116_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(492603..495002)
Genome map
AA seq 799 aa AA seqDB search
MENPSYNAIPACAWNRAIGLGWDKPYTVRKASNIDDGPWQGMPLGGFGAGCIGRSSRGDF
NLWHIDGGEHTFGNIPACQFSLFESSSNRNVAYALSTEPSNDSTLSAWEWYPSRSKGDSS
GTYHALYPRSWFVYENVFQSRLSCEQFSPIWADNYQESSYPVAIFLWNASNPTSEPVTLS
IMLTWQNMVGWFTNTLKSPEVEMRDDGSPVYDYQPNLGESKGNFNRLVTNSEYIGCVLDK
IGTAEPIEGEGSWCIATAKHPKVEIFHHNRWNPTSTGEDIWRSFAKTGSLANISDETPAI
SNEQVGAAIAVRFTLQPGESLQIPFAVAWDFPITEFVSGVTYKRRYTDFFGDNGKNAWNI
ATTALEEYQNWLSQVQAWQQPIVERPDLPDWFKMALFNELYDLTAGGTLWSAASKRDPIG
QFAVLECLDYRWYESLDVRLYGSFGLLNLFPELEKAVMRAFARAIPESDEKTRVIGYYYT
IGAESPLAVRKAAGATPHDLGAPNEHVWEKTNYTSYQDCNQWKDLGCDFVLQVYRDFIFT
GSNDIEFLADCWNAIVETLNYLKAFDKDGDGIPENSGAPDQTFDDWRLLGVSAYCGGLWL
AALEAAIAIAEVLSSKQVQVENLAAQKSIYEGWLEKSRPVYQEKLWNGKFYRLDSESGSD
VVMADQLCGQFYARLLKLPDIVPPECTMSALNSVYDACFLKFNQGKLGAANGLRLDGSPE
NPDATHPLEVWTGINFGIAAFLVQMGMKSEAFKLTEAVVNQIYEHGLQFRTPEAITATRN
FRACVYLRAMAIWAIYLVI
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatccgtcctataatgcaattcctgcttgtgcttggaatcgtgctattggttta
ggctgggataaaccctacacggttcgcaaagctagtaatattgatgatggtccttggcag
ggaatgcccctcggtggttttggcgctggttgtatcggtcgttcttcacgaggagatttt
aatctttggcatattgatggcggggaacatacttttgggaatattcctgcgtgtcagttt
agcttgtttgaaagtagcagcaatagaaatgttgcttatgcattatctacagaaccaagt
aatgattctactttatcggcttgggaatggtatccttcccgatccaaaggtgattctagt
ggaacttatcacgcgctatatccccgtagttggtttgtatatgaaaatgtgtttcaatcg
aggttaagttgcgagcaattttcgccgatttgggctgacaattaccaagaatctagctat
ccggtagcaatatttctgtggaatgctagcaatccaacttcagagccagttactttaagt
attatgttgacttggcaaaatatggtgggatggtttaccaatacactcaagtctcctgaa
gtcgaaatgcgggatgatggtagtcctgtttatgactatcaacccaatttaggtgaaagt
aaaggtaattttaatcggttagttacaaattctgaatacattggttgtgtattagataaa
ataggtaccgcagaacctatagaaggggaaggttcctggtgcattgcaactgctaaacat
ccaaaagttgaaatatttcatcataatagatggaatccaactagtactggtgaagatatt
tggcgaagttttgctaaaaccggttctttagctaatatttccgatgaaacccccgcaatt
tcaaacgagcaagttggggcagcgattgcggtacgttttactcttcaaccaggagaaagt
ttacagataccttttgctgttgcttgggattttcctatcactgagtttgtatctggtgtt
acatataagcgcagatatacggatttttttggcgataatggtaagaatgcttggaatatt
gccaccactgctctagaagagtatcaaaattggctaagccaagttcaagcttggcaacaa
ccaattgttgagcgtccagatttgcctgactggttcaaaatggctttgtttaacgaactt
tacgatctcacggctggtggtactttatggagcgcggcttcaaaacgagatcctataggt
caatttgcagtacttgaatgtttggactatcgctggtacgaaagtttggacgtgaggctt
tatggttccttcggcttgctaaatttgtttcctgaattagaaaaagcagtaatgcgcgcc
tttgcaagagcaattcccgagagtgatgaaaaaactcgtgtcattggttactactatact
attggagcagaaagtcctttagctgtacgtaaagctgccggtgcaacccctcacgactta
ggcgcgcccaacgaacacgtttgggaaaaaactaattacaccagctatcaagattgcaac
caatggaaagatttgggttgtgattttgtgctacaagtttatcgagattttatttttaca
ggtagtaatgatattgaatttcttgcagattgttggaatgccattgttgaaactttaaac
tacctcaaagcatttgataaagatggcgacggtattccagaaaattccggtgcccccgat
caaacttttgatgactggcggttgctgggtgtaagtgcttattgtggcggactatggttg
gcagccctagaagcagcgatcgccatcgctgaagttttatcaagcaagcaagtgcaagtc
gaaaacttagcggcgcaaaaatctatttacgaaggttggctagaaaaatctcgtcccgtt
taccaagaaaaactatggaacggtaaattctatcgtctcgatagtgaaagcggttctgat
gtggttatggcagatcaattatgcggacaattctacgctcggttattaaagctaccggat
attgtacctccagaatgcactatgtcggctttaaattcggtttacgatgcttgttttctc
aaatttaatcaaggcaaactgggtgctgcgaatggtttgcgtcttgatggttctcccgaa
aatcccgatgcaactcatccgttggaagtgtggacgggaattaactttggaatcgctgct
tttctagtgcaaatgggaatgaaatcggaagcattcaagctaacagaggctgtagtaaat
caaatttacgaacacggcttacagttccggactcctgaagctattactgctactagaaat
ttccgcgcttgtgtttatcttagagcgatggctatttgggcgatttatttagtaatttga

DBGET integrated database retrieval system