KEGG   Rivularia sp. PCC 7116: Riv7116_0389Help
Entry
Riv7116_0389      CDS       T02364                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:riv01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:riv00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
495751..497199
Genome map
AA seq 482 aa AA seqDB search
MINCGTIKKIQVNLEERVSVLCLQYGMARGNTPIPQIPELSLGKHCPYSMLRIINQQADV
IAELQRICDRTNDEQVLHKEATVREVLQAVKRQGDKAVLHYTAEFDRQILNAEELRVTKS
EFDEAYKNISKDLLEGIKLASSKIEAFHRQRVPKSWVNFGDDEVVLGKRYTPVDTAGLYV
PGGRASYPSTVLMNGIPAKVAGVPRRVMVTPPGSEKGINPAVLVAAKEAGIEEIYRIGGA
QAIGALAYGTQTIPKVDVITGPGNVYVTLAKKLVYGTVGIDSLAGPSEVLIIADETANPI
HIATDLLAQAEHDPMAAAILLTTDAALAKDVKVALERQLVDHPKRLNTEKAIAHYGLVVI
VESLEVAAQFSNKFAPEHLELEVSDPWALLPLILHAGAIFLGHSTPEAVGDYLAGPNHTL
PTSGAARYASALGVETFLKHSSIIQYSQTALDKVAGAIDILATAEGLPSHAESVRRRIRT
EG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgattaactgtgggactattaaaaaaatacaggttaatctagaggagagagttagcgta
ctttgcctgcaatacggcatggcaaggggcaatactcccatccctcaaatccccgaattg
tctctaggaaagcattgtccttactccatgctgcgaattattaatcagcaggcagacgtt
atagcagaattgcaacgtatctgcgatcgcaccaatgacgaacaggtgcttcacaaagaa
gcaacggtgcgggaagtactccaagcggtgaagcgccaaggcgataaagcggtattacat
tacacggccgaatttgatcgtcaaatccttaatgctgaagaattacgagtaaccaagtcg
gaattcgatgaagcttacaaaaatatttctaaggatttgttagaaggaattaaactggct
agttcaaagattgaagcatttcatcgacagcgagttcctaaaagttgggtcaacttcggt
gacgatgaagtagttctaggtaaaagatatactcctgtagatactgcgggtttatatgta
ccgggtggtcgagcttcatatcctagcaccgtactaatgaacgggattccagcaaaagta
gcaggagtcccgcgtcgagttatggttacgccgccaggaagtgagaagggaatcaatccg
gcagtattagtagctgcaaaagaagccggaatcgaagaaatttatcgtattggcggagcg
caagcaatcggcgctttagcttacggaactcaaacgattcccaaagttgatgttataact
ggacctggaaatgtttacgtaaccttagcaaaaaagttagtttacggaactgtcggcatt
gactccctagctggaccaagcgaagtcttaattattgctgatgaaacagcaaatcccata
cacattgccacagatttattagctcaggcagaacacgatccaatggcagcagctatacta
ttgactaccgatgctgctttagccaaggatgtaaaggtagccttagaaagacaattagtt
gaccacccgaagcgattaaatacggaaaaagctatagctcattacggtttggtggtaatc
gtagaatccttagaagttgccgcacaattttctaacaaatttgctccagaacacttagaa
ttagaagtatccgatccttgggcattattacctttgattcttcatgctggagctatattt
ttaggtcattctaccccagaagctgtaggagactatttagcaggtcccaaccatacttta
cctacttctggtgcagctagatatgcttcagcattaggagttgaaactttcttaaaacac
tctagtattattcagtactcgcaaacagcactagataaagttgctggcgcgatagatata
ctagcgactgctgaaggcttaccatctcacgctgaatcggtaagacggcgaatacgaaca
gaaggttaa

DBGET integrated database retrieval system