KEGG   Rivularia sp. PCC 7116: Riv7116_0466Help
Entry
Riv7116_0466      CDS       T02364                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:riv00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
596112..598019
Genome map
AA seq 635 aa AA seqDB search
MSGIVGVHYLDGRPVNGEDLSKMVDILAHRGPDGADTWIGQSVGLGHRMLWTTRESLIET
LPLVKQDGNLVITSDARIDNREELIAALQINNRPSDKIGDSELILAAYGKWGEQCLEHLL
GDFAFAIWDKGKQQLFCARDHIGIKPFYYCRNSDTFVFASEIKAIHTLPNIERKVNETRI
AEYLLIVFEDKTTTFYQDIFRLPPGHCMTVSKEDIKIRCYWELNPQKELRLGSDEEYAEA
FREIFTEAVRCRLRSAFPIGSTLSGGLDSSAITCLARNLLDKNQPLHTFSVIFDEMSQCD
ERPFINEVLAQGNFTPHYLNGDKLTPLEDINRMMWYHDEPFYFANSYLYWNTCPIAKNEG
IRILLDGFDGDTSVSHGLGYFDELANQGRWFKLIKELKHREKYTEQSLWSSLSPYLWVHA
LKPSHRKFIYRVRRKLAKLNKFRKGKSNTQANTNQIINDKFVERITLKEHLQSLEEKRYK
PQPRERDCHYQSLNWGLIPFFLEVIDKSAAAASIEANHPLFDKRLVEFCLSLPPEQKIHQ
GWTRMILRRGMENILPKKVQWRTDKNNFEPAVIHALLDLNRELVEKVILHNSEDVEDYVD
MEAVRKIFQKLISERKPSDVIPVWVTTLLGYWRSK
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcatcgtcggcgtacattaccttgatggtcgtcctgtcaacggcgaagactta
tcaaaaatggttgatatattagcccatcgcggacccgatggcgcagatacctggataggt
cagtctgttggcttagggcaccggatgttatggactacccgcgagtctctcatagaaaca
ttacccttggttaagcaagatggtaatttagttattacatctgatgctcgcatcgataat
cgtgaagagttgattgctgcactacagataaataaccgcccttctgataagataggtgat
agcgaactgatactggcagcttacgggaagtggggcgaacaatgcctggagcatttatta
ggtgactttgccttcgcgatttgggataaagggaagcagcaactattttgcgctagagac
catataggaattaaacctttttactactgccgcaatagtgataccttcgtttttgcttct
gagatcaaggcaattcataccttacctaatattgagcgtaaagttaatgaaacccgaatc
gccgaatatctgctaattgtatttgaagataaaaccacaactttttatcaagatatcttt
cgattgcctcctgggcactgcatgactgtaagtaaggaagatataaaaataaggtgttac
tgggaattaaatcctcaaaaagaacttaggctaggttcagacgaagagtatgcagaagct
tttcgcgaaatattcaccgaagcagtacgctgtcgtctacgtagtgcgttccctatcggt
tctaccctcagcggtggacttgattcttccgctatcacctgtttagcaaggaatctctta
gataaaaatcaacctctgcataccttctctgtgatttttgatgagatgtcacagtgtgat
gagcgtccctttattaacgaagttttagctcaaggaaactttacacctcactatttaaat
ggtgataaattaactcctttagaagatatcaatcggatgatgtggtatcacgacgaacca
ttttattttgcaaactcgtatctatattggaatacttgtcctatagctaaaaatgaaggt
attcggattctgttagacggttttgatggggataccagcgtttctcacggcttaggatac
tttgacgaactagcaaatcagggacgatggtttaagttaattaaggagttaaaacacagg
gaaaagtatacagaacaatctttgtggagttcgctatcgccttatttgtgggtacacgca
ctcaaaccatcacatcgcaaatttatctatcgggtgcgacggaaactagcgaaactcaac
aaatttagaaaaggcaagagcaatactcaagctaatacgaatcaaatcatcaatgataaa
tttgtcgagcgtattactttaaaggaacatctgcaaagcttggaagaaaaaagatataaa
ccgcagccaagggaaagggattgtcactatcaatctttaaattggggacttatacctttc
tttctcgaagttatagacaagagtgcagcagcagcttctattgaagccaatcatccactg
tttgataagcgcttagtagagttttgtttatcacttcctcccgaacaaaaaattcatcaa
ggatggactcggatgatattacgtcggggaatggaaaatattctacctaaaaaagtgcag
tggcgtaccgacaagaacaactttgaaccagctgttatccacgcattattagatttgaat
cgcgagcttgtagagaaagtgattttacataattccgaagatgttgaggattatgtagac
atggaagcagtccgtaagatttttcaaaaattgatttctgaaagaaagcctagtgatgtt
attccggtttgggtaacaactcttttaggatactggcgttcaaagtaa

DBGET integrated database retrieval system