KEGG   Rivularia sp. PCC 7116: Riv7116_0722Help
Entry
Riv7116_0722      CDS       T02364                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:riv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(917887..919581)
Genome map
AA seq 564 aa AA seqDB search
MRNYNFLFLDNIFQQWRIIFLEMFYRKYFYKKKKRFKKNKFSQIKSYKKILIFLISLLFC
LNSNFINTLSGQVNLARAATTMQLPLSTRGAKIIDAKGARVLLQGVNWFGMETETHTPHG
LWKRDYKEMLAQIRSLGYNMIRLPYSVETLRSSEISGVDFTIGSNRELEGKTPIEVMDAV
VEEAQRQGLLILLDSHRLNNKRIPELWYGDGYSEADWINTWLQLAQRYKNQTNIIGADLK
NEPHGKASWGTNDLATDWRLAAERAGNAIGKINPNWLIVVEGVENNVPGQKLAHHWQGGN
LEGVLRYPVRLSQRNKLVYSPHEYGTGVYDMPYFSDKKFPQNLLDRWQIGFHYISSQNRA
PILIGEFGGRLIDEKEAIWFSKLIKYIKKKKLSFAVWSWNPNSEDTGGVLLDDWKSVDIP
KQQLISQLLPVKLPRMAPATVAQPQKPQARIPDTNAAIVAEAGLRVTTEVYSDWQTGFCT
SMKIINNTNQSVQNWQLKFNMNQAKIKNSWNANFKEFKGIYTATPLDWGKTIQPQKVRDV
GFCAQKLGSDYSPQQVELQVLATN
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaattataattttttatttttagataatatctttcaacaatggcggataatcttc
cttgaaatgttttatcgaaaatatttttataaaaagaaaaaaagatttaaaaaaaataaa
ttttcacaaatcaaatcctacaagaaaatactgatatttcttatcagcttattattttgc
ttgaatagtaattttattaacacgttatctggacaagtcaatctggctagagcagcaacg
actatgcagttaccactttcaactcgtggagcaaaaattattgatgccaaaggagctagg
gtattactccaaggagtcaactggtttggtatggaaacagaaacccatactccccacggt
ttatggaagcgagattataaggagatgctcgcccaaatcaggagcttgggttacaacatg
attcgtctgccatattctgtagaaacactgcgctcatctgaaattagtggcgttgatttc
actattggtagcaatcgagaactcgaaggtaaaacccctatagaagtaatggatgcagtc
gttgaggaagcacaacgtcaaggattattgattttgttggactcccatcgtctcaataat
aagcggattccagaattatggtatggagatggctattccgaagcagattggataaatacc
tggttgcagttagctcaaagatataaaaatcaaaccaacatcatcggtgcagatttaaaa
aatgaacctcatggtaaagctagttggggtaccaacgatttagctaccgattggaggtta
gccgcagaacgcgcaggtaatgccattggtaagataaatcctaattggttaattgttgtt
gaaggagtagaaaataatgttccgggacaaaaattagctcaccattggcaaggaggtaat
ttagaaggtgtattgcgctatccggtacgtttatcacagcgaaataagctagtttattct
cctcatgagtacggaactggggtgtatgacatgccttatttctctgacaagaaatttccc
caaaatctcctcgatcgctggcaaataggctttcattatatttccagtcaaaatcgcgct
cctattttgatcggagaatttggcgggcgtttaattgatgagaaagaagctatttggttt
agtaagttaattaaatatattaagaagaaaaaactaagtttcgctgtttggagttggaat
cccaatagtgaagatacgggaggtgttctcttggatgattggaaaagtgttgatataccc
aaacaacaattaatttctcaactacttccagttaaattacctcgcatggctccggcaaca
gttgcacaaccacaaaaaccgcaagcgcgaattccagatactaatgccgcaattgtagcc
gaagcaggattacgagttactactgaagtttattccgattggcaaacgggtttttgtact
agcatgaaaataattaataataccaaccaatcagttcaaaattggcagcttaaattcaat
atgaaccaagctaaaataaaaaattcttggaatgctaatttcaaagaattcaaaggtata
tataccgcaactcctttggattggggaaaaactatacagccccaaaaggtacgggatgtc
ggtttttgtgcccaaaagctcggttccgattattctcctcaacaagttgaattacaagtt
ttagcaacaaattaa

DBGET integrated database retrieval system