KEGG   Rivularia sp. PCC 7116: Riv7116_0795Help
Entry
Riv7116_0795      CDS       T02364                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:riv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1018664..1020172
Genome map
AA seq 502 aa AA seqDB search
MPFPRSSGILLHPTSFPSRFGIGDLGHEAYRFIDFLKDGYQQYWQILPLGPTGFGNSPYM
CYSALAGNPLLISPDKLRDAGLLSDDDFNNLPEFPLDNVDYHQVESTKIPLLKKACSNFK
ANHNKEQLQAFEEFCYSKAYWLDDYTLFMALKDSTGGASWNSWDKDIAKRKPRAIEKAKK
ELESEVFYHKFLQFQFYSQWSELRKYANESGVEIIGDIPIYVAHDSADVWGNPENFCLDK
DTGEAALMAGVPPDYFSATGQLWGNPVYDWKQLEKQKFKWWVHRFEAMLDYVDIIRIDHF
RGFESYWAVPLGEETAVNGKWIEAPGNKLFETIKKQLGSLPVLAEDLGTITPEVEALRDK
FEFPGMKVLQFAFGGDAGNPYLPFNVQENNCVIYTGTHDNDTTVGWYEKANDDEKRNLNF
YLGSISPDGVHWDLIRLAMGSVANVAIFPLQDILGLGSNARMNIPSLGEGNWEWRYRTEA
MNSELSQRMKDFVQFFGRAPIS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcctagaagtagcggtattttgcttcatcctacaagtttccccagtcgcttt
ggtattggcgatttggggcatgaagcttaccgttttattgattttcttaaagatggttat
cagcagtattggcaaattctacctttaggtcctactggttttggtaattctccttatatg
tgctattcagctttagcgggcaatccgctgttgattagcccggataagttgcgggatgca
ggtttactcagcgatgatgattttaacaatctacctgagttccctttggataacgttgat
tatcaccaagtagaatctaccaaaattcctttgttgaaaaaagcttgttctaattttaaa
gctaatcataacaaggagcagttacaggcttttgaggaattttgctattcaaaagcttat
tggctggatgattatactttatttatggcgcttaaggatagtaccggaggtgctagttgg
aatagctgggataaggatattgccaagcgcaaaccgagagcgatagaaaaggcaaagaaa
gaattagaaagtgaagttttttatcacaagtttctgcaattccaattttatagtcagtgg
tcggaattaagaaaatacgccaatgaatcgggtgtggaaattattggcgacattccgatt
tatgtagctcacgatagcgccgatgtttggggaaatccagaaaatttttgcttggataaa
gatactggagaagctgcgttaatggctggggtaccaccagattactttagcgctaccggt
caattgtggggtaatccggtttacgattggaagcagttggaaaagcaaaagtttaagtgg
tgggtgcatcgttttgaggcgatgctcgattatgttgatattattcgtatcgaccatttt
cgaggatttgaatcttactgggctgtacctttaggtgaagaaactgccgtgaatggtaag
tggatagaagcacctggaaataagttgtttgaaactattaaaaagcaacttggtagttta
cccgtattagcggaagatttgggaactatcaccccagaagttgaagctttacgggataag
tttgagtttcccggtatgaaggttttgcagttcgcttttggtggagatgctggcaatcct
tatttaccttttaacgttcaagaaaataattgtgtaatttacaccggaactcatgataac
gacactaccgtaggttggtatgaaaaagccaacgatgatgagaaacgtaacttaaatttc
tatttaggttctataagccccgacggagtgcattgggatctgattcgtttagcaatgggt
tcggttgctaacgtcgcgattttccccctacaggatattttgggattgggttctaatgcg
agaatgaatattccctcgttaggtgaaggtaattgggaatggagatatcgaactgaagcg
atgaattccgaattatctcaacggatgaaggattttgttcaattctttggaagagcgcca
atcagttaa

DBGET integrated database retrieval system