KEGG   Rivularia sp. PCC 7116: Riv7116_0887Help
Entry
Riv7116_0887      CDS       T02364                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
riv  Rivularia sp. PCC 7116
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Riv7116_0887
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Riv7116_0887
Enzymes [BR:riv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Riv7116_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1129123..1130193
Genome map
AA seq 356 aa AA seqDB search
MNFGNHLIIGVSGTELTDEDKRILSTIKPVGVCFFAKNFRDGEPYEVWLETYKKLSQEIR
EYTERESMFISIDHEGGRVIRPPLPITRFPYSYVCRKRARAVAKAMATELKSLGINVSWA
PVADIFSNPSNPIIGPRSFDTTPEAAAEYAREYFIGLKESGIIACAKHFPGHGDTNTDSH
LALPVLNLTKEAIEKRELIPFKTLIAEKIPLIMTAHILFPEIGGDKPATFSQSILNQILR
KELGFEGVVVSDDLDMKAVADMYDKSGTVANTLNAGCDIFLMCGNLPSSSTERIEFIAED
FFKSLANGSLDESVVAAANSRIEKLLSDTPQYTVEMLDKSVLLQHAELAIACSFDN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcggaaatcatttaattatcggtgtttcaggtactgaattaaccgatgaagat
aaaagaatattaagtacaatcaaacctgtaggagtttgctttttcgcgaaaaatttccgc
gatggagaaccctatgaagtttggttggaaacttacaaaaaactcagccaagaaatcaga
gaatataccgaacgcgaatcgatgtttatttccatcgatcatgaagggggaagggtaatt
cgtccacctttgccaattacgcgatttccttatagttatgtttgtcgcaaacgagcgcgg
gcagtcgcgaaggcgatggcaaccgaactcaaatccttgggtatcaacgtatcttgggca
ccagtggcagatatattttccaaccccagcaatcccatcatcggacctcgttccttcgat
acaacaccagaagcagccgccgaatatgcccgcgaatattttatcggactcaaagaatcg
ggaattatagcctgtgccaaacatttccccggacacggagataccaacaccgattctcac
ttagcattgccggtactcaatttaactaaggaagctatagaaaaacgagaattaatacct
ttcaaaactttgattgccgaaaaaattcccttaattatgacagctcatatcctcttccca
gaaatcggaggggataaaccagcaacattttctcaatcaattttgaatcagatattgaga
aaagaacttggttttgaaggagttgtggtatcggatgacttagatatgaaagccgttgcg
gatatgtatgacaaaagcggtaccgtcgcaaatacattaaatgcaggctgcgatatattt
ttgatgtgcggtaatttgccatcgtcatccaccgaacgaatcgaatttattgctgaagat
tttttcaagtcgttagcaaacggtagccttgatgaatcagtggtagcagcagctaatagc
agaattgagaaacttttgagcgatacaccgcagtatacagtggaaatgctcgataaaagc
gttttattgcaacatgcagaactggcgatcgcctgtagttttgataattaa

DBGET integrated database retrieval system