KEGG   Rivularia sp. PCC 7116: Riv7116_1078Help
Entry
Riv7116_1078      CDS       T02364                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00900  Terpenoid backbone biosynthesis
riv01100  Metabolic pathways
riv01110  Biosynthesis of secondary metabolites
riv01130  Biosynthesis of antibiotics
Module
riv_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Riv7116_1078
Enzymes [BR:riv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Riv7116_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: AFY53652
UniProt: K9R966
Position
1375640..1376836
Genome map
AA seq 398 aa AA seqDB search
MKAITLIGSTGSIGTQTLDIVAQCPEQFKIVGLAAGRNVELLASQIRQFQPSIVAISDET
KLSQLKEAIKDVQPQPTLLAGEDGVIEVARYAEAETVVTGIVGCAGLLPTIAAIKAGKDI
ALANKETLIAGAPVVLPLIEKHQVKLLPADSEHSAIFQCLQGIPEGGLRKIILTASGGAF
RDWDVAKLADVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYDDIEIVI
HPQSIIHSLIELQDTSVLAQLGWADMRLPLLYALSYPERICTDWERLDLVKAGSLTFREP
NHQKYPCMKLAYAVGKAGGSMPAVLNAANEQAVALFLEEKIHFLDIPRCIETVCDRHGAQ
NNSNPNLDDILTADKWARKEVIKAANNLQNAPKVVSMR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctattactcttattggttctactggttctataggaactcaaactttagatatt
gttgctcaatgtccggaacagtttaagattgtcgggttagccgcagggcgcaacgtagaa
ttgttagcatctcagattcggcagtttcaaccgagtatagtcgcaatttctgatgaaact
aaattatcgcaacttaaagaggcaataaaagacgtacagcctcaaccaactttactagcg
ggagaagatggagttatagaagttgctcgttatgcagaagctgaaactgtagttacaggt
attgttggttgtgctggattattgcctactattgctgccatcaaagcaggaaaagatatt
gctttagctaataaagaaactttaattgctggggcaccagtagttttacctctaatcgaa
aagcatcaagtaaaactgctacccgcagattcagaacattcggcaatttttcaatgtctg
caaggtattcctgaaggcggtttacgcaagattatacttacagcctctggtggcgctttc
cgcgattgggatgtagcaaaattagctgatgtcacagtagccgatgctcttaaacatcct
aattggtcaatgggacgtaaaattacagtagattcggcaactttaatgaataaaggtttg
gaagtaattgaagcgcacttcctgtttggattagattatgacgatattgaaattgttatt
catccccaaagcatcattcattcattaattgaattgcaagacacttcagttttagctcag
ttgggttgggctgatatgcggctacctctgctgtatgctttatcttatccagagcgtatt
tgtaccgattgggaacgattggatttagtcaaagcaggctcattaacattccgagaaccc
aatcatcaaaagtatccttgtatgaaactcgcttatgccgtcggaaaagccggtggctct
atgccagcagttttaaacgcagccaacgagcaagctgtagccttatttttagaagaaaaa
atccactttttagatattcctcgctgcatagaaacagtctgcgatcgccatggagcgcaa
aataattcaaatcccaatttagatgacattttaacagccgataaatgggcaagaaaagaa
gttataaaggctgccaataatttgcaaaatgcaccgaaagtagtttcgatgcggtaa

DBGET integrated database retrieval system