KEGG   Rivularia sp. PCC 7116: Riv7116_1427Help
Entry
Riv7116_1427      CDS       T02364                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Riv7116_1427
Enzymes [BR:riv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Riv7116_1427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1806369..1807280)
Genome map
AA seq 303 aa AA seqDB search
MSIIVFGSINIDLVATAPRLPTAGETLLGHDFFQAPGGKGANQAVAIAKLGIPTEIIGRV
GKKSFSEELINYLQAAGVKTDNVFVDETASSGVAIINVDDAGENQIVVIPGANERVNLED
VERLSQLLPGKKALLLQLEIPISSVIAAAKEAKKAGVKVILDPAPAQKELPEELYPLVDI
LTPNEVEAAQLVGFPVNGEDSAKKAAEVLLQKGVKCAVVKLGAKGVYCSTAAESFFTPAF
SVKTVDTTAAGDAFNGGLAAAISQGFSLRKAIVWGSAAGALAATKSGAQPSLPDRETFDK
FLQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtctattatcgtctttggtagcattaatatagatttggtagcaacagcaccccgttta
ccgactgctggagaaacgctgttagggcacgatttttttcaagcaccgggcggtaaaggt
gctaatcaagcagttgcgatcgcaaagttaggcattcctaccgaaattattggacgtgtc
ggcaaaaaaagttttagcgaggaacttattaattatctacaagctgccggtgtcaaaaca
gataatgtgtttgtcgatgaaacagcaagctctggtgtagcaattattaatgtagatgat
gccggtgaaaatcaaatcgtagttattcccggtgctaatgagcgggtaaatttagaagat
gtcgaaagattatcgcagctattaccggggaaaaaagcacttctattacaattagaaatt
ccgatatcttctgttattgcagcagccaaggaagcaaaaaaagccggagttaaggtaatt
ctcgatccagcaccagcacaaaaagagttaccagaagaactttaccccttagtagatatc
ctgacaccgaatgaagttgaagccgctcaactagtaggttttccggtaaatggagaagat
tcagccaaaaaagcagcagaagttttattgcaaaaaggcgtgaaatgtgcagttgtaaaa
ctcggtgccaaaggcgtttattgctctacagcagcagaaagcttcttcacaccagctttt
tccgtaaaaacagttgacaccacagccgccggagacgctttcaacggaggattagccgca
gcaatttcccaaggattttccttacgtaaagccatcgtttggggtagtgcggcaggtgcc
ttagctgcaaccaaatccggcgcacagccttccctaccagatagggaaacttttgataaa
tttttacaataa

DBGET integrated database retrieval system