KEGG   Rivularia sp. PCC 7116: Riv7116_1501Help
Entry
Riv7116_1501      CDS       T02364                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:riv00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Riv7116_1501
Enzymes [BR:riv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Riv7116_1501
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Riv7116_1501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1887925..1888830)
Genome map
AA seq 301 aa AA seqDB search
MPELPEVETVRRGLNQLTLKRKITGGDVLLDRTIAYPFSAEDFLNGLQQREITTWHRRGK
YLIAELSSVLEDKETREQGDKNSSSLATFSLPSSSLGVHLRMTGQLLWLNQNEPLHKHAR
VRLFFGEEWELRFVDQRTFGQMWWVPPKVETQSIITGLAKLAADPFSTEFTVDYLADKLK
NRRRPIKTALLDQSVVAGLGNIYADEALFLSRIQPQTLCLNLQREQIQRLHSAIIQVLKT
SIEAGGTTFSNFLNVQGVNGNYAHVAWVYNRTGEPCRTCSNPIERIKLAGRSSHFCPECQ
Q
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaactaccagaagttgaaacagtccgacggggtttaaatcaattaacccttaag
cggaaaattacgggaggtgatgtgttgctcgatcgcaccattgcttacccgttttctgct
gaagattttttaaatggtctccaacaaagggaaataacaacttggcatcgtcgcggtaag
tacctaattgcagaacttagttcagttttagaagacaaggagacaagggaacaaggagac
aagaattcttcttccttagccactttcagcctcccctcctcctccctgggggttcattta
cgaatgactggtcagctattatggttgaatcaaaatgaacctttgcacaagcacgcgcga
gtcaggttgttctttggtgaagaatgggaattgcgcttcgtggatcagcgtacttttggt
cagatgtggtgggttcctccaaaggttgaaacgcaaagcattattaccggtttagcaaag
ctagcagcagaccctttttcaacagaattcactgtagactatcttgcagacaaactcaaa
aatcgccgccgccctatcaagactgcgctactagatcaatctgtggtggcggggttaggt
aatatttatgctgatgaagcgttgtttcttagtagaatacaaccccaaaccctgtgtcta
aatttgcaaagagaacagatacagcgtctgcattctgcgattattcaagtcttaaaaact
agtattgaagctggtggtactactttcagtaatttcttgaatgtacaaggcgtgaatggt
aactacgcacatgtagcttgggtttacaaccgcaccggagaaccttgtcgaacttgtagc
aatccaattgagcgaattaagttagcgggaagatccagtcatttttgtcccgagtgtcag
cagtga

DBGET integrated database retrieval system