KEGG   Rivularia sp. PCC 7116: Riv7116_1522Help
Entry
Riv7116_1522      CDS       T02364                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Riv7116_1522
Enzymes [BR:riv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Riv7116_1522
Peptidases [BR:riv01002]
 Cysteine Peptidases
  Family C44
   Riv7116_1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1909996..1911732)
Genome map
AA seq 578 aa AA seqDB search
MKEIVGYWGSGNISELKTILTRIFSQASVEKELQQVNYQKHDCFGALAQWSFTNNYSISN
EGIFKTKEFCQVSLSAAGISELADAVIKFENQRLVLSRDCFGRIPLYWFQKEQVIWFATR
IQLLLPVLDSPQVSIPGFYGYNCFSYVPTPLSPIENIFTVPAGCEIVWEINQNHQIQNHQ
IQNCYRWQETEDLIKDEKTAILQLQDLLKNSIYRQLSNLPQEVGVFLSGGLDSSVVAALL
VQAGVKVKAYALDFGEYGISELPFAEVVAKHLEIPLVKVDATPKRIKSAMKATVKALDLP
FGDGVTIPIYLLCEAASKETSVIFNGEGGDQLFAGWTNKPLIAAGIYNSEDFNLQYLRTF
HRLYGYEGQCFQSELISQIKNINPETWIAEALNPEFINNILARLRRASLMLKGAQNIHPR
ATNLGKAFNLRVRSPFCDLPLAEWSFALSGELCLQGNTEKYILKKAVESWLPSEIVWREK
RGMGVPLNSWCLGELWGEVSKRLNQGILKFEGFYQEDIILKVLEGEIGGQIRQRRIGEVL
WLLLMWEMWRVEVLGEKVEGKVFDYQLLWLRVLQKFKK
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaaattgtcggttattggggtagcggtaatatttctgaattaaaaactattttg
actcggatttttagtcaagcgtctgttgagaaagagttacagcaagtcaattatcaaaaa
catgattgctttggtgctttagcccaatggagttttacaaataattattctatcagtaat
gagggaatttttaagactaaagaattttgtcaagtttcgctttctgctgcgggaatttca
gagttagcagatgcagtaattaagtttgaaaatcagcgtttagttttaagtcgagattgc
tttggaagaatccctttatattggtttcaaaaagagcaagtaatttggtttgcaacgcga
atacagttgttattacctgttttagattctccacaagttagtattccaggtttttacggc
tataactgtttttcttacgtaccgactcctttaagccccatagaaaatatttttacggta
cccgcaggatgtgaaattgtttgggaaattaatcaaaatcatcaaattcaaaatcatcaa
attcaaaattgttatcggtggcaagaaactgaagatttaatcaaagatgaaaaaacggca
atattgcagctgcaagatttactaaaaaattctatttaccgtcaattaagtaatttacct
caagaagttggagtatttctttctggagggctagattcttctgttgttgcagctttgtta
gtgcaagctggagtaaaagttaaagcttacgctttggattttggcgaatatggaatatct
gaattaccttttgctgaagttgtggctaaacatttagaaattcctttggtaaaagttgac
gcaacaccgaagcgaattaaatcagcaatgaaagctaccgtcaaagctttagatttacct
tttggtgatggggtaacgataccgatatacttactttgtgaagcggcatcaaaagaaaca
tcagtaatttttaatggtgaagggggagatcaattatttgctggatggactaataaacct
ttaattgccgccggtatttataattctgaggatttcaatcttcaatacctgcggactttt
catagactttacggttatgaagggcaatgttttcaatccgaattaattagtcaaataaaa
aacattaatccagaaacttggattgctgaagcattaaacccagaatttatcaacaatatt
ttagctagattgcgaagagctagtttgatgctcaaaggcgcgcaaaatattcatcctaga
gctacaaatttgggaaaagcatttaatttaagagtgcgatcgcctttttgcgatttacca
ttagctgagtggagttttgcgctttctggagaactttgtttgcagggtaatactgaaaaa
tatattcttaaaaaagccgttgaatcttggctaccgtcagaaattgtttggcgagaaaaa
cgcggtatgggagtacctttaaatagttggtgtttgggtgagttatggggtgaagttagt
aaaagattgaatcaaggtattttgaaatttgaagggttttatcaagaagatattatttta
aaagttttagagggtgaaatcggcgggcaaattcgtcagcgtcgtatcggtgaagttttg
tggctgctgttgatgtgggagatgtggcgagttgaagttttaggtgagaaagttgaaggg
aaagtttttgattatcaattgttatggttgagggttttgcagaagtttaagaagtga

DBGET integrated database retrieval system