KEGG   Rivularia sp. PCC 7116: Riv7116_1639Help
Entry
Riv7116_1639      CDS       T02364                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Riv7116_1639
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Riv7116_1639
Enzymes [BR:riv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Riv7116_1639
Lipid biosynthesis proteins [BR:riv01004]
 Desaturase
  First
   Riv7116_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2050900..2051841
Genome map
AA seq 313 aa AA seqDB search
MQLDNTTVVKHRKTIAVDSRLKSIRLFHVLLITLIPLMGFFITLILVMAGNLIEPLDIGL
FLGMWFVSGTGITVGFHRHFAHHSFKTSKPLRIVLAIMGCMAAQGPVIYWVSLHRRHHEN
SDQVGDPHSPHLEKESILQLFRGLWYAHIGWMFNHEFPNPFNYTPDLVGDKTISWVDRLY
FFWLFLGLAIPTFMGGVIKGSWSGAFDGFLWGGLVRLFFTENFIWSINSITHVYGHRWFN
TNEQSRNNIWLAIPTIGEAWHNNHHAFPKSAKFGLKWWQIDLGYWFIRILEMFGLVWDVQ
VPTVGMIEAKKIA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcaattggataacactacagtagtcaagcatagaaagactatagctgttgacagtaga
ctgaaaagtatacgactatttcatgtgttactcatcaccttgatacctttgatggggttt
ttcataaccctaattttggtgatggcaggaaatcttatcgaacctttagatataggactt
ttcttaggtatgtggtttgtaagtggaactggtattacagtgggctttcaccgccacttt
gcccaccatagcttcaaaaccagcaaacctttaagaattgttctagcaattatgggttgt
atggctgcacaaggacctgtaatttattgggtttcgctacacagaagacatcatgaaaac
agcgaccaagttggagatcctcattcaccccacttagagaaagaaagcattttacaacta
tttcggggtctatggtatgcccatattggctggatgttcaaccatgaatttcccaatcca
tttaactatactccagaccttgttggagacaaaactatttcttgggtggatcggctttac
tttttctggctttttctgggattagctatccccacttttatgggaggtgtaatcaagggg
tcttggagcggagcatttgacggatttctttggggaggacttgtaagattgttttttact
gaaaactttatttggagtatcaattccattactcatgtttatggtcatcgttggtttaat
accaatgagcaaagtagaaacaatatttggttagccatccccactattggagaagcttgg
cataacaaccatcatgcttttcccaaatctgcgaagtttgggttgaaatggtggcaaatt
gatttgggttactggttcatccgcatccttgaaatgtttggtttggtttgggatgtccaa
gttcctactgtaggaatgatagaggctaaaaaaatagcgtag

DBGET integrated database retrieval system