KEGG   Rivularia sp. PCC 7116: Riv7116_2080Help
Entry
Riv7116_2080      CDS       T02364                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Riv7116_2080
Enzymes [BR:riv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Riv7116_2080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2585944..2587458
Genome map
AA seq 504 aa AA seqDB search
MSFERASGVLLHPTSLPSKFGIGDLGESAYKFVDFLVSSGQKLWQILPLGPTGYEHSPYT
MNFSAFAGNPLMISLEQLLEEGLLTPEELTPLEKVNDNPHRVDFDAVIPHKTKILQKAYQ
RFQKSLAKIANKEFENFCKAQATWLDDYVLFMALLEANDYKAWNFWDSAVARREKDALKA
EENKLKDKVSYHKFLQFKFFQQWKKIRDYANNKDIKIVGDISIYVCHNSSDVWANPEIFQ
LNSETLESAYIAGVPPDYFSATGQLWGNPVYDWDKLEETNFAWWIERFRATLEYVDIVRI
DHFRGFEAYWRVPAGEETAINGEWVKGPDAKFFETLNSALGSLPVMAEDLGIITPEVEEL
RDRFDLPGMRILQFAFGGEADNPYLPHNYIPNCVVYPGTHDNDTSIGWWNQTGEAEKQHV
AKYLGYSSPEEIKEINWEFIRMALSSVGDLAILSVQDFLDLGNEGRMNDPSVSAGNWRWR
YQSDEQLTQEISQRLLEMTRLYNR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgaaagagcaagtggagttttgctgcatccaactagtttgccaagtaaattt
ggcattggtgatttaggtgaatcggcttataagttcgttgatttccttgtttcaagcggt
caaaaattgtggcaaattctacctttaggacctacaggttacgaacattcaccctacacg
atgaattttagcgccttcgctggaaatcccttgatgatttctttagaacagttgctagaa
gagggtttgctaactccagaagaactaactcctctcgaaaaggtaaacgataatcctcac
agagttgattttgatgctgttattcctcacaaaacaaaaattcttcaaaaagcttaccaa
cgctttcaaaaatctttagcaaaaatagctaataaagaatttgaaaatttttgcaaagca
caagctacttggttggatgattatgtgctgtttatggcattactagaagccaacgattat
aaagcttggaatttttgggatagtgctgtagctcgtcgcgaaaaagatgcgctcaaagca
gaggaaaataaattaaaagacaaggtatcataccataaattcttgcaatttaaattcttc
caacagtggaaaaaaatacgcgattacgctaacaataaagacatcaaaatagttggcgac
atatcaatttatgtttgccataatagttccgatgtttgggcaaatccagaaatatttcag
ttaaattcagaaactctagaatctgcttatattgctggagtcccaccagattactttagc
gctaccggtcaactttggggtaatcccgtatacgattgggacaaactagaagaaactaac
tttgcttggtggatagaacgttttcgagcaactttagaatatgtagacattgtccgtatc
gaccatttcaggggatttgaggcctattggcgagtacccgcaggagaagaaacagccatc
aacggcgaatgggtaaaaggaccggatgccaaattctttgaaactttaaattctgcttta
ggtagtttacctgtaatggcagaagacttaggaattattacccccgaagtagaagaattg
cgagatagattcgatctacctggaatgcgtatcttgcaattcgcctttggtggagaagcg
gacaatccttacttaccacataattacattcccaactgcgttgtttatcccggcactcat
gacaacgacaccagcattggatggtggaatcaaacaggagaagcagaaaagcaacacgta
gccaaatacttaggatattcttcacccgaggaaatcaaagaaatcaactgggaatttatt
cgtatggctttatcttcagtaggagacttagccattctttcagtccaagacttcttggac
ttaggtaatgaaggtagaatgaatgaccccagcgttagtgccgggaactggcgctggcgc
tatcaaagcgacgagcagcttacccaagagataagtcaaagattgttagaaatgacccga
ctttataacaggtaa

DBGET integrated database retrieval system