KEGG   Rivularia sp. PCC 7116: Riv7116_2271Help
Entry
Riv7116_2271      CDS       T02364                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:riv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2809699..2810349
Genome map
AA seq 216 aa AA seqDB search
MTLSFRPELNSAEEVVSSLSTQNKPKVTDEEMMQAVRTLLLGLGEDPDREGLKDTPKRVV
KALQFLTKGYNESLDELLNGAVFTEDANEMVLVRDIDIFSSCEHHILPILGRAHVAYIPN
GKVIGLSKIARICEMYGRRLQVQERLTLQIAEALEGLLKPQGVAVVVEASHMCMVMRGVQ
KPGSWTVTSAMRGVFAEDAKTREEFMNLIRHKANFH
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgactttatcttttcgtcccgaattaaattctgccgaggaagttgtttcatctttatct
acacaaaataaaccaaaggttacggatgaagaaatgatgcaagctgtgagaactttacta
cttggattaggagaagacccagatagagaaggacttaaagatactcctaaaagagttgta
aaagccttacagtttttgaccaagggatacaatgaatctttggacgaactgttaaatggt
gcagtatttacagaagatgccaatgaaatggtattagtcagagatattgatatttttagt
tcctgcgaacaccatattttaccaatccttggtcgcgctcatgtagcttatattcctaat
gggaaagtcattggattatcaaaaattgcccgcatttgtgaaatgtacggaagacgttta
caagtgcaggaaagattgactttacaaattgctgaagcactcgaaggtttactcaaacct
caaggtgtggcagtagttgtagaagctagtcatatgtgtatggtaatgcgtggcgtacaa
aaacctggttcttggactgtaaccagtgcaatgcgtggtgtattcgcagaagatgccaaa
actcgcgaggaatttatgaatttgattcgacacaaagctaattttcattaa

DBGET integrated database retrieval system