KEGG   Rivularia sp. PCC 7116: Riv7116_2368Help
Entry
Riv7116_2368      CDS       T02364                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:riv00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Riv7116_2368
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Riv7116_2368
Enzymes [BR:riv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Riv7116_2368
Two-component system [BR:riv02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Riv7116_2368
Bacterial motility proteins [BR:riv02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Riv7116_2368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2935384..2935953)
Genome map
AA seq 189 aa AA seqDB search
MTPENYIVVITASAGGLNAISEILSKLPSNFPAPIAIAQHLDPKRPSMLAEILDKRSPLS
VKQAKAGDKLYPGKVYIAPPDLHLLVNPDGSLSLSRSEKVHYVRPAGDVLFKSVAASFKE
KCIAVVLTGMDGDGAAGVQEIKKMGGIVIAQDKSTCKYPSMPDSAIQTGDVDFVIPLESI
ARSLMYLMQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacacctgaaaactatatagtagtaattacagcatcagccggaggacttaacgctatt
agcgaaattttatcaaaattaccatcaaattttcccgcaccgattgcaatagcacaacat
ttagatcccaaacgtcccagtatgttagcagaaattttggacaagcgaagtcctttatct
gtcaagcaagctaaagcaggggataaactatatccgggtaaggtttatatcgctccaccc
gatttacatcttctggtgaatccagatggttctttatctttatctcgctcggaaaaagtg
cattatgtgcgtcctgctggtgatgtactatttaagtcagttgcagctagcttcaaagaa
aaatgtattgccgttgttctcaccggtatggatggagatggtgctgcgggagtacaagag
ataaaaaagatgggtggtatagttattgctcaagacaaaagtacttgcaaatatcctagt
atgccagattctgcgattcaaactggtgatgtagattttgttatacctcttgaatctatt
gcgcgttccttaatgtatttaatgcagtag

DBGET integrated database retrieval system