KEGG   Rivularia sp. PCC 7116: Riv7116_2411Help
Entry
Riv7116_2411      CDS       T02364                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Riv7116_2411
Enzymes [BR:riv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Riv7116_2411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2984927..2985583)
Genome map
AA seq 218 aa AA seqDB search
MTLSIRPELPSSNRTLSSLSKQETHPPNVTEAEMMEAVRTLLIGLGEDPNREGLKDTPKR
VVKALQFLTKGYHESLDELLNGAVFTEDANEMVLVRDIDVFSSCEHHILPVIGRAHVAYI
PNGKVIGLSKVARICEMYARRLQVQERLTVQIADALQGLLKPQGVAVVLEASHMCMVMRG
VQKPGSWTVTSAMRGVFAEDAKTREEFMNLIRHKPNFG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgactctatctattcgtcctgaactcccttcttctaatcggacgttatcgtctttatcc
aaacaggaaactcatcctccaaatgtaaccgaagcagaaatgatggaggctgtacgtact
ttactgattggattaggagaagatccaaatcgtgaaggactaaaagatacgccaaaaaga
gttgtcaaagctttgcagtttctcactaagggatatcatgagtctctcgatgaactgtta
aatggtgcagtatttactgaagatgccaacgaaatggtattggttcgagacattgatgtt
ttcagttcttgcgaacaccatattttaccagttattggtcgcgctcatgtagcctatatt
ccaaatggaaaggtaatcggattatctaaagttgctcgaatttgcgaaatgtatgcacga
cgcttacaggtgcaggaacgtcttaccgtacaaattgctgatgcactacagggtttatta
aaaccacaaggggtggctgtggttttagaagctagtcacatgtgtatggtaatgcgcggg
gtgcaaaaaccaggttcttggactgttactagtgcgatgcggggagtatttgctgaagat
gccaaaactcgcgaggagtttatgaatttgatccgacacaagcctaattttgggtag

DBGET integrated database retrieval system