KEGG   Rivularia sp. PCC 7116: Riv7116_2541Help
Entry
Riv7116_2541      CDS       T02364                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Riv7116_2541
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Riv7116_2541
Enzymes [BR:riv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Riv7116_2541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3148042..3149034)
Genome map
AA seq 330 aa AA seqDB search
MPTTTWTRHHVLSLADFTATEYNAVLQTAASFQEVLTRRMKKVPTLQGQVVANLFFEPST
RTRSSFELAAKRLSADTLNFSAASSSMTKGETILDTAKTYLAMGTDIMVVRHREAGVPNA
IATEMNRLGVKVSVLNAGDGQHEHPSQGLLDLFTICSLLDQEKPSIELLQGKKIAIVGDI
LHSRVARSNIWSLTAATDAELHLAAPPTLLPKLFADYGKDRAGKLFVHWELEPALQDADF
VMTLRLQKERMTAHLLPSLREYHQLFGITRDKLRNCKENVKVLHPGPVNRGVEISSDLMD
DPDFSLIQNQVTSGVAVRMALLYLIGSGKA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcctactaccacctggactcgtcatcacgtactttccctggctgatttcaccgcaact
gaatacaacgcagttttacagactgccgctagttttcaggaagtgctaacgcggcggatg
aaaaaagtgcctactttgcagggacaggtggtggcgaatttgttttttgaaccatctact
cgaactcggagtagttttgaacttgctgcaaagcgcttgagtgcagatactctcaacttc
tccgccgcaagttcttctatgacaaaaggagaaacaatcttagatacagccaaaacctat
ttagcgatgggtaccgacatcatggtggtgcgccatcgagaagcaggagtaccaaacgcg
atcgcaacagaaatgaaccgtttgggtgtaaaagttagcgtgttaaatgctggtgacgga
caacacgagcatccttctcaagggctgttagatttgtttactatttgtagcctgcttgac
caggaaaagcccagtatagaactgctgcaaggtaaaaaaattgccatcgttggcgatatt
ttacattctcgggttgctaggtcaaatatctggagtttaaccgccgctaccgatgcagaa
ctacatttagcagcaccaccgacgcttttgccgaaattatttgcagattacggcaaagat
agagcggggaagttattcgtacattgggaattggaaccagctttgcaagatgcagatttt
gtcatgacgttgcgtttacaaaaggaacggatgacagcccatttattgccttctttgcgg
gaatatcatcaattatttggaattacaagagataaattaagaaattgcaaggaaaacgtg
aaagtactgcatccgggacctgttaatcgaggtgttgaaattagttcggatttaatggat
gacccagattttagtttaatacagaatcaggtgacgagtggggttgcagtcaggatggct
ctgctgtatttaattggcagtggaaaagcttaa

DBGET integrated database retrieval system