KEGG   Rivularia sp. PCC 7116: Riv7116_2891Help
Entry
Riv7116_2891      CDS       T02364                                 

Definition
3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Riv7116_2891
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Riv7116_2891
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Riv7116_2891
Enzymes [BR:riv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Riv7116_2891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3576366..3583811
Genome map
AA seq 2481 aa AA seqDB search
MAGQLSHDKVRFATFNASLNRNNAGELITDLSTPDNEQAKAVAEIIQRTNPDVLLLNEFD
YDENGEAIANFKQNYLEVAQNGVDAVEYPYVYLAPSNTGISSGFDLNNDGTVGTESFDLA
NDAFGFGTFPGQYGMVLLSKYPIEESEIRTFQNFLWKDMPNGFLTNDPSIDNPDTEVNEN
LNGFYSAEEIEVLRLSSKSHWDIPVNVNGEIIHVLASHPTPPVFDGEEDRNGKRNHDEIR
FWADYVTPGNGEYIYDDSGETGGLNSGAKFVIMGDQNADPNDGDSTDNAILQLLDNPQIN
TAVTPSSEGGIDAAIRQGLNNLTQTGNPAFDTADFAEENFGGPGNIRADYVLPSNNLDIE
SAGVFWPEGDEAEFDLVGDFPFPSSDHRLVYADVEKTNVDRKTVSNVNFLGEVTFPTGLQ
LEETEVGGISGLAYDASKGIYYGLSDDRSQINPARFYDISIDLSDGSLDDGDISFDSVTT
LLDEDGNAFPEFSLDPEGIVLTKNNTLFVSSEGDTNQLINPFVNEFSLAGQEIGELPVPA
KFLPTANQSSGIRNNAAFESLTITPDERYLYTAAEDALFQDGERADLDNGSLVRIAKYDL
QTREVVGEFVYELDEVAEVPEPADGFKVNGLVELLATDNNGSLLALERSFSVGKGNTVKL
YEVQTQGALDVSGVNDLFREEPLEDDGEILAPGAFEIDPAVNKRLLVDFADLGITPDNLE
ALAFGPTLPDGSQSLIVASDNNFNDTQTTQFLALGLDFDTTPAVLPTVETPYTIDNEEVL
EPKPLNILLVNDDGFEAEGIEVMYDALVAAGHNVTFVAPKEQQSGKGTLINVDNLGQPTE
VVEFEPNKWYIDASPVVTTLAGLDFVLNGEEPDLVISGINEGENVGASVAISSGTVSAAT
TATRRNIPAIAVSAGTLRDAAFNVDEAELEKAYQTGADTVVDLVKQLSLYSSASDNSKLM
PDGVGLNVNIPPVVDDIEGISYTKLDGTGTFNLFVDELAPDVPGLLFTQGEEIEPSEITV
EDSEGQNFLADFITVTPIDGDWTASDNVRQTLSDRIESAPENPTATPLNILLTNDDGFDA
PGIETLYNQLTAAGHNVTLVGPFEQQSGTGTVLDVDKIFQPLDITNVGGDKWYVDAGVRT
TTWAGLDYVLDEQPDLVISGINAGENIGPGGAVSSGTVSAAVTALLREVPGIAISGGIDF
ATFETPDTTYDIGADYLVNLIAQLQATQGEDDFILPDGKGLSINIPTRLPDGVDEIQPAV
FTNASDTEPFNIDFGPVDEDGNVGLRFAPNAIPTEPNPTSEGDQFLSGFITVTPIDGDWT
APQSEREIAESILTAPEPVLAGDSDDPAIWVNPDNSAESIVIGTLKDGGLATFNLQGEIQ
QVISAPGFGEQALLGENENQEFEEFGDSEALLQAERRFNNVDIIYNFPLASMIMGGETKV
DLAVASDRENDTLAIFSISENGQLNKLPTPQLDDAEFSIFGVDDGEATAYGLATYTSPVS
GKSYVFVTQADGNKVAQIELTSKLGPADEQLIEAEVVRTLELPTPTGDAEDSQSEGVVID
QELGFLYVALEDQVGILKFSAEPDAGSDFTVVQSVDADYLTPDIEGLSIYYGDNGTGYLI
ANSQGDSSYAVFSREGNNEYLGSFVVGDNNGIDQVNESDGLDVINVPLGEEFPNGLLVLQ
DGANDPQNAVEDDEELENNSTNFKFVPWDGVANSFDNSLQINTSSYDPRNPKPQSLINGI
ASGDTTQNSTVLWARSTFVGEVTFEYSTDAEFNSVIGTVTANVENTNVPVKVEINGLNPG
TEYYYRVTDAAGDSAIGEFETSAETGTKAGLRFGVAGDWRGEISPYPAISNASESDLAFF
VEHGDTIYADYGSAAVLNEDGSFKEQAETLDEYRAKHGEVYGTRFGQNTWTDLRASTSIL
ATIDDHEVINDFAGGEPAADDARFPEQAGLINDTELYENGLQSFQEYNPLRDEFYENTGD
ELTEGERKLYRNNTYGSDAAVITLDNRSFRNQALDNPDATTLGIDLASGVDQTTAFTNFV
VNEVLPFETAAFDPTRTMLGQPQLEDLKQDLLKAEQDGTTWKFVMVPEPMQALGPLLGPA
DRFDGYLNERTEILQFVEDNDIDNVVFIAADIHGTLVNNLTYQEQPGGPQIATNAFEVTT
GSVAFDAPFGQSVTNGAAQLGFVTPEQLQQYNSLPILNAPAGVPSKDDFFTQLLNDAALT
PFGLDPVGLEADSGIDAELIQGGYVAAHTFGWTEFDINAETQALTVTTYGIEPYSEEELL
ANPEAITSREPQIVSQFVVNPQEVDPLSATLIDTSNKDADGNEIELIDLTAYAGQTVTAS
YEINREADYDNNVYFYTVGDEGKIGELAPTDGTEYIQAALNNVVNSSQGLTTPDEQITMG
TLEIAGGDMLGVLIVADGNLSEAKNNLDSVEGVYFSYMGANTDNGSFDHIKFENGMFKFE
DLVNGGDEDFDDIEIKMEFTV
NT seq 7446 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcagctaagtcacgacaaggtgcgttttgctacatttaatgcttctttgaat
cgtaataatgcaggggaattaattaccgatttatctaccccagataacgagcaagccaaa
gctgtagccgaaatcattcagcgaacaaatcccgatgttttgttattgaatgagtttgat
tatgatgaaaatggggaggcgatcgccaatttcaagcagaactatttagaagttgctcaa
aatggtgttgatgctgttgagtatccctacgtttatttagcaccttccaatacaggtatt
tcttctgggtttgatttaaataatgatggtactgttggcactgaaagctttgatttagct
aatgatgcttttggttttggtactttccccggacaatatgggatggtattgttatccaag
tatcctatagaagaatcagaaataagaactttccagaattttttatggaaggatatgcca
aatgggtttttgactaatgaccctagtattgacaatcccgatacagaagtcaatgaaaat
ttgaatgggttttattctgctgaagaaatagaagtactgcgtttatcttctaaaagtcat
tgggatattccggttaatgtaaatggtgaaattattcacgttttagcttctcaccccaca
cctccagtatttgatggtgaagaagatagaaacggtaaacgcaatcacgatgaaatccgc
ttctgggctgattatgtaactcctgggaatggtgaatatatttatgatgatagtggtgaa
actgggggtttaaactccggtgcaaaatttgtcatcatgggagaccaaaacgctgacccc
aacgatggtgacagcacagataatgcaattttgcaactattagataatcctcaaattaat
actgctgttactccttcgagtgaaggtggaattgatgcagcgattcgtcaaggtttgaat
aatcttactcaaactggtaatccagcatttgatacagcagattttgcagaagaaaatttt
ggtggtcctggaaacataagagcggattatgttttaccttctaataatttagatattgag
tcagctggagtattttggccagaaggtgatgaagctgaatttgatttagtcggagatttt
cctttccccagttccgaccatcgtttggtttatgctgatgttgagaaaaccaatgttgac
cgcaaaactgtttctaatgtgaatttcttgggagaagttacttttcctactggtttacag
cttgaggaaacggaagttgggggaatttctggtttagcttacgatgcttctaagggaatt
tattacggattatctgacgatagaagtcaaatcaatcccgctcgtttttacgatatatcc
attgatttaagcgacggttctttggatgatggggatattagctttgatagtgttactact
cttttagatgaagatggtaatgctttcccagagttcagtctcgatccagaaggaattgtt
ctcaccaaaaataatactttatttgtttcttctgaaggggatacaaatcaattaatcaat
ccttttgttaacgagttttccctagctggacaagaaattggtgaattaccagtaccagcg
aaattcctacctacagcaaaccaaagcagcggaattcgcaacaatgctgcttttgaaagc
ttaactattactcccgatgaacgttatttatatactgctgctgaagatgcacttttccaa
gatggtgaaagagcagatttagataatggttctttggtaagaattgctaaatacgattta
caaaccagagaagttgttggtgaatttgtttatgaattggatgaagtcgctgaagtacca
gaacctgctgatggttttaaagtaaatggtttagtcgaattacttgctactgataataac
ggtagtcttctagctctggagcgttctttttctgtaggaaaaggtaacacggttaaactt
tacgaagtccaaacccaaggtgctttagatgttagcggtgtaaatgatttattccgtgaa
gaacctttagaagatgatggagaaattttagctcctggtgcttttgaaattgatccagcg
gttaataagcgtttgttggtagactttgctgatttgggaattactcccgacaatttagaa
gctttggcttttggtcctacattaccagatggtagtcaaagtttaattgttgctagcgat
aataattttaacgacactcaaacaactcagtttcttgctcttggtttagatttcgatact
actcccgcagttcttcccactgtagaaactccttacaccattgataacgaggaagttctc
gaaccaaaaccgttaaatattctgttggttaacgatgatggttttgaagcagaaggcatc
gaagtcatgtatgatgctcttgtcgctgctggtcataatgttaccttcgttgcaccaaag
gaacagcagagcggtaagggaactttaattaatgtagataatctgggacaacctacagaa
gttgttgaatttgaaccaaataaatggtatatagatgcttctcctgtagttacaacttta
gctgggttagattttgttcttaatggtgaagaaccagatttagttatttccgggattaac
gaaggggaaaacgttggtgcttctgttgcgattagttctggtacggtaagtgcagcaact
accgctactcgtcggaatattcctgcaattgctgtcagtgctggaactttgcgagatgct
gcttttaatgttgacgaagcagaattagagaaagcttatcaaacaggtgctgatacagtt
gttgatttagttaaacaactcagcctttactctagcgctagtgataatagtaaactaatg
ccagatggagttggtttaaatgtcaatattcctccggttgtagatgatattgaaggtatt
tcctacaccaagttagatggaactggtactttcaacttgtttgtagatgaacttgctccc
gatgttcctggtttacttttcactcagggagaggaaatagaaccttcagaaattacagtt
gaagattccgaaggacaaaacttccttgctgattttattaccgtaactcctattgatgga
gattggacggcgagtgataatgtccgtcaaactttgagcgatagaattgaatctgctccc
gaaaatcccacagcaacacctttaaatattctgctcaccaacgatgatggttttgatgct
cctgggattgaaactctctacaatcaacttactgctgctggtcataatgtaactttagtt
ggtccttttgaacagcaaagcggtaccggaacagtacttgatgtagataaaatcttccaa
cctcttgatattaccaatgttggaggtgataagtggtatgtagatgctggagttcgtact
actacctgggctggtttagattatgtcttagatgaacaaccagacttagtaatttctggg
attaatgcaggtgaaaatattggacctggtggtgcggtttcttctggtacggtaagtgca
gcagttacagcattattaagagaagtaccaggaattgcaattagcggtggaattgatttc
gctacttttgaaactcccgataccacttacgatattggtgctgattaccttgtaaattta
attgctcaacttcaagcaactcaaggtgaagatgatttcattcttcctgacggtaaaggt
ttaagtattaatattcctactcgtttaccagatggtgtagatgaaattcaacctgctgta
tttacaaacgctagcgacaccgaaccatttaatattgattttggtcctgtagatgaagat
ggtaacgtcggactcagatttgctccaaacgcaattcctacagaacccaatcccacatca
gaaggagaccaattcttatcaggtttcattaccgttaccccaattgacggagattggaca
gcaccccagagcgaaagagaaatcgctgaaagtattttaactgctccagaaccagtttta
gctggtgattctgacgaccccgcaatttgggtaaatcccgataattcggctgaaagtatt
gttatcggaactttgaaagatggtggtttagctacctttaatttacaaggagaaattcaa
caggtaatttcagcaccaggatttggggaacaagctttattaggggaaaacgagaaccaa
gaatttgaagaatttggcgatagcgaagcgctgctgcaagcagaacgccgtttcaacaac
gttgatattatctacaatttccctctagcatcaatgataatgggtggggaaacaaaagtt
gatttagcggttgcttccgatagagaaaatgacactttagctatctttagtatttccgaa
aacggtcaactaaataaattacctacaccacaattagatgatgcagaattttcaattttt
ggtgtagatgatggggaagcaacggcttacggtttagcaacttataccagtccggtttct
ggaaaatcctacgttttcgttacccaagctgacggtaataaagttgctcaaatcgaatta
acttctaaattaggtcccgctgacgaacaattaatagaagcagaagttgttcgtacttta
gaattaccaacacccacaggtgatgcagaagattctcaatcggaaggagttgtaattgac
caagaactgggtttcctttacgtagcgctggaagaccaagtaggtatactcaagttctct
gccgaaccagatgctggtagtgattttactgtagttcaatctgtagatgctgattaccta
actcccgatattgaaggtttatcaatatactacggtgacaacggaactggttatttaatt
gctaacagtcaaggtgattcttcctatgctgttttcagtcgtgaaggtaataacgaatat
ttgggtagtttcgttgttggtgataataacggaattgaccaagtaaatgaaagcgatggt
ttagatgtaattaacgtacctttgggtgaagaattccccaacggattattagtattacaa
gacggagcaaacgacccgcaaaatgctgttgaagatgatgaagaattagaaaataacagc
accaactttaaatttgtaccttgggatggagtcgcaaattcattcgataattccttacaa
attaacaccagcagctatgacccacgcaatccaaaaccacaatccttaattaacggaatt
gctagcggtgataccacccaaaattctacagtattgtgggcgcggagtacattcgtgggt
gaagtcacctttgaatattccactgacgcagaattcaattccgttatcggaacagttacc
gcaaacgtagaaaacactaacgttcccgtcaaagttgaaattaacggtttaaatccagga
accgaatattattatcgcgttaccgatgctgctggcgatagtgcaatcggtgaatttgaa
acttctgccgaaactggaacaaaagcaggtttacgctttggtgttgctggagattggaga
ggtgaaatttctccttaccccgcaattagtaatgcctcggaaagcgatttagcattcttc
gtcgaacatggtgatacaatatacgccgattatggttcagccgcagtcctgaacgaagat
ggaagtttcaaagaacaagcggaaactcttgacgaatatcgcgctaaacacggtgaagtt
tacggaactcgcttcggtcaaaatacctggactgatttacgcgcttcaacctcaattctg
gctacaattgacgaccacgaagtaattaacgactttgcaggtggagaaccagctgctgac
gatgctcgtttcccagaacaagcgggtttaattaacgatacagaactctacgaaaacgga
ctgcaatctttccaggaatacaaccccctacgggatgaattctatgaaaatacgggtgat
gaacttaccgaaggcgagcgcaaactatatcgtaacaatacttacggtagcgatgcagca
gtaattacccttgataaccgttccttccgcaatcaagccttagacaatcctgatgcaacc
acattaggcatagacttagcatcaggagttgaccaaactactgctttcaccaactttgta
gttaacgaagtacttccttttgaaactgctgcatttgaccccactcgaacaatgttgggt
cagccgcaattagaagacttaaagcaggatttactcaaagccgaacaagacgggacaact
tggaagttcgtcatggtacccgagccaatgcaggctttgggaccattgcttggacctgcc
gaccgtttcgacggatatcttaacgaacgtaccgaaattctccagtttgttgaagataac
gacattgataacgtcgtatttatcgctgcggatattcacggaactttggttaataattta
acttaccaagaacaacctggtggtccgcaaattgctactaatgcctttgaagttaccact
ggttctgtagcttttgatgcaccatttggtcaaagcgttaccaatggtgcagcacaactt
ggttttgtgactcccgaacagcttcaacaatacaacagtttacccatactcaatgcaccc
gcaggtgttcccagcaaagatgatttctttactcaattgctcaacgatgcagctttaaca
ccattcggtttagacccagttggtttagaagcagatagcggaattgatgcagaattaatc
caaggtggatatgtagcagcacatacctttggttggactgagttcgatattaatgcagaa
actcaagcattaaccgtaaccacatacggtattgagccatattccgaagaggaattactg
gcaaatcccgaagcaattaccagcagagaaccgcaaatagtcagtcaatttgtggttaat
cctcaagaagtagacccattaagcgctactctcattgacaccagcaataaagatgcagat
ggaaatgagatagaattaattgacctcacagcatacgcaggtcaaaccgtaacagctagt
tatgaaattaaccgagaagctgattacgacaacaacgtttacttctatacagttggtgac
gaaggtaaaattggcgaactagcacctacagatggaactgagtatatccaagctgcatta
aacaacgttgttaattcaagccaaggattaacaactcccgacgaacaaataactatggga
accttggaaatagcaggtggtgatatgcttggtgttttgattgttgctgacggtaatctt
agtgaagctaagaacaaccttgatagtgtagaaggagtttacttctcttacatgggagca
aacaccgataacggaagtttcgaccacatcaaatttgagaatggtatgttcaaatttgaa
gacttagttaacggtggtgatgaagatttcgacgatattgaaatcaagatggaatttacc
gtgtaa

DBGET integrated database retrieval system