KEGG   Rivularia sp. PCC 7116: Riv7116_3339Help
Entry
Riv7116_3339      CDS       T02364                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Riv7116_3339
Enzymes [BR:riv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Riv7116_3339
Exosome [BR:riv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Riv7116_3339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4144387..4146684
Genome map
AA seq 765 aa AA seqDB search
MTMTTIAPEQVNSIINNQHSDPFKILGSHKIEKDGKNVWVVRAYLPTASAAWVVLPEERK
EEPMQSVHDPHFFECTVDAEELANYQLKIKEEDQERVFYDAYAFNSPKLTEFDLHLFNEG
NHHRIYEKLGAHFTEIKGVKGVYFAVWAPNARNVSILGDFNSWDGRKHQMRKGPTGVWEL
FIPGLEVGEHYKYEIKNTAGHIYEKSDPYGFAQEVRPKTASIVTDLDAYKWNDSEWMEKR
RHSDPLSEPISVYELHLGSWLHAGTDEPSLLPDGTSEPVVQVSELKTGARFLTYRELAAK
LIPYVKELGYTHIEMLPVAEHPFDGSWGYQVTGYYAPTSRYGSPEDFMYFVDECHKNGIG
VLVDWVPGHFPKDGHGLAFFDGTHLYEHADPRKGEHKEWGTLVFNYSRHEVRNFLTANAL
FWFDKYHIDGIRVDAVASMLYLDYCREPGTWVANEYGGRENLEAVEFIRSVNHLIFSYFP
GSLSIAEESTSWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNLTFSM
WYHHSENFMLALSHDEVVHGKSNIIGKMPGDRWQKFANARCLFAYMFAHPGKKTMFMSME
FGQWSEWNVWADLEWSLMQFEPHQQLKIFFQDLNKLYRNEPALYTQDFEEAGFQWIDCSD
NRHSVVSFIRRDKDSDGFVVAICNFTPQPHSHYRIGVPEPGFYTELFNSDAREYGGSNMG
NLGGKWTDSWSMHNQEHSLDLCLPPLGVLVLKLDRNKTGEVMEEE
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgactatgaccactattgccccagaacaggttaacagcatcatcaacaaccagcatagc
gaccctttcaaaatacttggttcccacaaaatagagaaggatggcaaaaacgtctgggtt
gtgcgagcttatttgcctaccgcaagtgctgcttgggttgttcttccagaagagcgtaag
gaagaaccgatgcaaagcgtgcatgaccctcatttctttgaatgcacggtagatgctgaa
gaattagctaactatcaacttaagattaaagaagaagaccaagaacgggtattctatgac
gcttatgcttttaattctcccaagctaacagaattcgatttgcacctgtttaatgaagga
aatcatcaccgaatttatgagaaattaggagcgcatttcactgaaattaaaggtgtaaaa
ggcgtttattttgcggtttgggcaccgaatgcgcgtaatgtatcgattttgggagacttc
aacagttgggatggacgcaagcatcaaatgcgtaaaggtcccactggagtatgggagcta
tttattcccggattggaggtaggagagcattacaaatacgaaatcaaaaataccgcagga
catatttacgaaaaatctgacccctacggttttgctcaggaagttcgtcctaaaactgct
tctattgttactgacttagatgcttataagtggaatgacagcgaatggatggaaaaacgc
cgtcatagcgatccactttccgaaccaatttcagtttatgaactacatttaggttcgtgg
ttgcacgccggtactgacgaaccatccttactaccagatggtacatccgagcctgtagta
caggtttctgaacttaaaactggcgcgcgttttctaacttatcgggaattggcggcaaaa
ctgattccttatgttaaagaattaggctatacccatattgaaatgctgccagtagccgaa
catccatttgatggttcttggggatatcaagtaactggttattacgctcctacttcccgt
tatggcagtcctgaagactttatgtactttgtggatgaatgtcataaaaacggcattggc
gtgcttgtggattgggttcccggtcactttcctaaagatgggcatggtttagccttcttt
gacggtactcatctttacgaacatgcagatcctcgtaagggcgaacataaagagtgggga
actctagtatttaattattcgcgtcatgaagtacgtaattttctgacagcgaatgcttta
ttttggtttgataaatatcatattgacggtattcgcgttgatgcagtggcttcaatgctt
tatttagattactgtcgcgaacccggtacctgggttgcaaatgaatatggtggtagagaa
aatttagaagcagtagaatttattcgcagcgtaaatcacctcatttttagttacttcccc
ggttcgctatccattgcagaagaatctacttcatggccgatggtatcttggcctacatac
accggtggattgggctttaacctgaagtggaatatgggttggatgcatgacatgctcgat
tacttcagcatggacccctggttccgtcagttccaccaaaataatctgacttttagtatg
tggtatcaccacagcgaaaactttatgttggcgctgtcccatgacgaagtggtgcatggt
aagagtaatattatcgggaaaatgcccggagatagatggcagaagttcgcaaatgcgcgt
tgtttatttgcctatatgtttgctcatcccggtaagaaaaccatgtttatgagcatggaa
tttggacagtggagcgaatggaatgtttgggcagatttggaatggagcttaatgcagttt
gagccacaccaacagctcaaaatattcttccaagatttaaataaactttaccgcaacgaa
cctgctttatacactcaagactttgaggaagcagggtttcaatggattgactgtagcgac
aatcgtcatagcgtagtttcatttatccgtcgcgataaagattcggatggttttgttgtt
gctatttgtaatttcaccccgcaaccccattcccactaccgcatcggtgtaccagagcct
ggattctacactgaattatttaacagcgatgcccgagaatacggcggtagcaacatgggt
aatttaggcggtaagtggactgatagctggtcaatgcacaatcaagaacactccttggat
ttatgtcttccacctttaggagtattagttttgaaattggatcgaaataaaactggtgag
gtgatggaagaagagtaa

DBGET integrated database retrieval system