KEGG   Rivularia sp. PCC 7116: Riv7116_3404Help
Entry
Riv7116_3404      CDS       T02364                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Riv7116_3404
Enzymes [BR:riv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Riv7116_3404
Exosome [BR:riv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Riv7116_3404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4232506..4234041
Genome map
AA seq 511 aa AA seqDB search
MMMQSRGNTNQQASYILALDLGTTGNRAFVFDANAQIVGQAYLELKQYYPQPGWLEHDAT
EIWSATISVIQSAVKQAEISPSQIAAIGLTVQRETCLLWDKNTGKPLRKAIVWQDRRTAP
LCNELQNQGLAEEIYQRTGLVIDAYFSATKLSWLLDSVAGIDLDNVLAGTIDTWVLWNLT
GRKVHATDHSNASRTMLMNLETCDWDETLLNLFKIPRHILPQIQPSLSQFGLTDKDLLGT
EIPITAILGDQQASLFGHGCNAPGLMKCTYGTGSFLVAHTGSEIVRSQSQLLSTVAWTQV
NQSGSLEISYALEGSMFTSGACIQWLRDGLQLIETAAQTETIATQVDDNGGVYFVPALSG
LGAPHWDMSARGSFLGITAGVTREHMVRSVLEAITYQVKEVVEAINASSKTSINKLAVDG
GGSNNNFLMQFQADLLGIPIEQPVMRDTTVQGIAFAAGLSIGLWNDYSQLIEQRTIETVF
EPNLNSNNIQDIQDNYATWLRAVERGKNWEQ
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcagagtaggggcaatacaaaccaacaagcaagttatattctggctttagat
ttgggtactacgggcaatcgtgcttttgtctttgatgccaacgctcaaattgtgggacaa
gcatacctcgaactcaaacaatattatcctcaaccgggatggttggaacatgatgctacc
gaaatttggtcagctacgatttcggtaatccaaagtgctgttaagcaagcagaaatttcc
ccttcacaaattgctgctattggcttaacagttcagcgagaaacttgtttgctgtgggat
aagaacaccggaaaacctttacgtaaagcaattgtctggcaagatagacgtactgctccc
ctttgcaatgaattacaaaaccaaggtttggcagaggaaatttatcaacgtactggatta
gttattgatgcttacttttctgcaacaaagctttcttggctgttggattctgttgcagga
attgacctcgataatgttttggctgggacaattgatacttgggtgttgtggaatctaacc
ggtagaaaagttcatgcaactgaccacagcaatgccagtcgcacaatgttaatgaatttg
gaaacttgcgattgggatgaaacgttattaaatttattcaaaattcctcgtcatatttta
ccgcaaattcagcctagtttaagccaatttggattgacagataaagatttactaggaaca
gaaattcctataactgctattttaggcgaccaacaagcgtctttatttggtcatggttgc
aatgctcccggcttaatgaaatgcacttacggtactggtagctttttggtcgctcatact
ggcagcgaaatagtgcgatcgcaaagtcagcttttgagtactgtggcttggactcaagtc
aatcaaagcggttctttagaaataagctatgctcttgaaggcagtatgtttactagtggt
gcttgtatacaatggttgcgcgatggtcttcagttaattgaaacagccgctcaaaccgaa
acaatagcaactcaagtagacgataacggtggagtctattttgtaccagctttaagtgga
ttgggggcacctcactgggatatgagcgctagaggttcttttttaggtatcactgctgga
gtcaccagagaacatatggttcgttcggtattggaagcaattacttatcaggtaaaagaa
gttgtggaagctattaatgcatctagtaagacttctatcaacaagttggctgtagatggt
ggtggttccaacaataattttttaatgcagtttcaagcagatttattaggaattcccatc
gaacaaccagtgatgcgagacactacggtacagggtattgcatttgctgctggtttatca
attggtttatggaatgattattcacaattgatagaacaaagaactatagaaacagtattt
gaaccgaatcttaattctaataatattcaagatattcaagataattatgctacttggctg
cgtgctgttgaacgtggaaaaaattgggaacagtga

DBGET integrated database retrieval system