KEGG   Rivularia sp. PCC 7116: Riv7116_3535Help
Entry
Riv7116_3535      CDS       T02364                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Riv7116_3535
Enzymes [BR:riv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Riv7116_3535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4391888..4392373)
Genome map
AA seq 161 aa AA seqDB search
MHDSVIALGSNIGDSLTILEAAVKTLHKIPGITGSMKSSWYQTKAIGPPQPDYLNGCISL
RADIEPFKLLEILLQIENQFGRERKQRWGARTLDLDLLLYDDLILHTPTLQIPHPRMTQR
AFVLVPLAEIVPHWIEPISGRTIKELLDDVDCSDVCLLTSN
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
ttgcatgatagcgtcattgcccttggtagtaatataggggattcactgacaattttagaa
gcagctgtaaaaactctacataaaataccgggtattacaggctcaatgaaatctagctgg
tatcaaaccaaagcaattggaccaccgcagccagattatttaaacggctgcattagttta
cgtgctgatattgaaccttttaagctattagaaattttattgcaaatcgaaaatcaattc
ggacgcgaacgaaaacaacgttggggggcgcggactttagatttagatttgttattatac
gatgacttaatattgcataccccaactctacaaatacctcatccccgaatgactcaaagg
gcttttgtgctagtgccattagcggaaattgttccacattggatagagccaatcagcgga
cgcacgattaaagaactacttgacgatgtagactgttccgatgtatgcctgctaacaagc
aattaa

DBGET integrated database retrieval system