KEGG   Rivularia sp. PCC 7116: Riv7116_3598Help
Entry
Riv7116_3598      CDS       T02364                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Riv7116_3598
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Riv7116_3598
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Riv7116_3598
Enzymes [BR:riv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Riv7116_3598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4486492..4487796
Genome map
AA seq 434 aa AA seqDB search
MQAATNIQNQTLTHAFHALKCKECGAEYELEAKNVCEFCFGPLEVSYDYSKLRQTVTRQT
IEAGPNSIWRYRQFLPVTSENPIDVGTGMTPLVRSHRLARRLGLKKLYIKNDAVNMPTLS
FKDRVVSVAMTRAKELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKILGS
LIYSPTLMAVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGFEVAEQLGWEL
PDHIVAPLASGSLFGKIYKGFNEFKEVGLVKDKKVRFSGAQAEGCSPIAKAFKEGRDFIQ
PEKPNTIAKSIAIGNPADGIYAVEIANKTNGNIESVNDTEIIEGMKLLAETEGIFTETAG
GTTIAVLKKLVEAGKIDPEETTVVYITGNGLKTQEAIQGAIGEPLTIDAKLDSFESALER
SRTLERLEWQQVLV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagcaaccaacatccaaaaccaaactcttactcatgcctttcatgctttgaaa
tgtaaggaatgtggtgcagagtacgaacttgaagcgaaaaatgtatgtgagttctgcttt
ggtcctttggaggtaagctacgattacagcaaattgcgtcaaaccgtaactcgccaaact
attgaagcgggtcctaattctatatggcgctatcgtcaatttttgcctgtaactagcgaa
aaccccattgatgttggtactggcatgactcctttggtacgctcgcaccgtttagcgcgt
cgtttgggtttaaagaaactatatataaagaacgatgcggttaatatgcccaccctcagc
ttcaaagatagggtggtttccgttgccatgactcgcgctaaggaattgggtttcaccacc
gtatcctgcgccagcaccggaaacttggcaaactcgactgctgcgatcgcggctcatgca
ggtttggattgctgcgtgttcatacccgccgatttagaagccggtaaaattttaggaagt
cttatttatagccctactttaatggctgttaaaggcaactacgaccaagtgaaccgttta
tgttcggaagttgccaacacccacggatggggatttgtaaatattaatttacgtccctat
tattccgaaggttccaaaacattaggttttgaagttgcagaacagttaggttgggaatta
ccagatcatattgtggctcctttggcaagcggttcgttgtttggcaaaatttataaagga
ttcaacgaatttaaagaagttggtttagtaaaagataaaaaggttcgattcagcggcgca
caagccgaaggatgttcccccatagctaaagcatttaaagaaggacgcgattttattcag
ccagaaaagcccaataccatcgcaaaatccattgccattggaaacccagcagatggaatt
tatgcagtagaaattgcgaacaaaaccaacggtaatatagaatcagtcaacgatacagaa
attatcgaaggcatgaagctgcttgcagaaaccgaaggtatatttacagaaactgctggt
ggtacaacaatcgcagtattaaagaaactggtggaagcaggaaaaattgacccagaagaa
accacagttgtttacattaccggcaacggcttaaaaacccaagaagctatacagggtgct
atcggcgaacctttgacaattgacgcaaaactcgatagttttgaatcagccctagaacgt
tctcgcaccctagaacgcttagagtggcagcaagtattagtttaa

DBGET integrated database retrieval system