KEGG   Rivularia sp. PCC 7116: Riv7116_3598Help
Entry
Riv7116_3598      CDS       T02364                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Riv7116_3598
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Riv7116_3598
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Riv7116_3598
Enzymes [BR:riv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Riv7116_3598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4486492..4487796
Genome map
AA seq 434 aa AA seqDB search
MQAATNIQNQTLTHAFHALKCKECGAEYELEAKNVCEFCFGPLEVSYDYSKLRQTVTRQT
IEAGPNSIWRYRQFLPVTSENPIDVGTGMTPLVRSHRLARRLGLKKLYIKNDAVNMPTLS
FKDRVVSVAMTRAKELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKILGS
LIYSPTLMAVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGFEVAEQLGWEL
PDHIVAPLASGSLFGKIYKGFNEFKEVGLVKDKKVRFSGAQAEGCSPIAKAFKEGRDFIQ
PEKPNTIAKSIAIGNPADGIYAVEIANKTNGNIESVNDTEIIEGMKLLAETEGIFTETAG
GTTIAVLKKLVEAGKIDPEETTVVYITGNGLKTQEAIQGAIGEPLTIDAKLDSFESALER
SRTLERLEWQQVLV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagcaaccaacatccaaaaccaaactcttactcatgcctttcatgctttgaaa
tgtaaggaatgtggtgcagagtacgaacttgaagcgaaaaatgtatgtgagttctgcttt
ggtcctttggaggtaagctacgattacagcaaattgcgtcaaaccgtaactcgccaaact
attgaagcgggtcctaattctatatggcgctatcgtcaatttttgcctgtaactagcgaa
aaccccattgatgttggtactggcatgactcctttggtacgctcgcaccgtttagcgcgt
cgtttgggtttaaagaaactatatataaagaacgatgcggttaatatgcccaccctcagc
ttcaaagatagggtggtttccgttgccatgactcgcgctaaggaattgggtttcaccacc
gtatcctgcgccagcaccggaaacttggcaaactcgactgctgcgatcgcggctcatgca
ggtttggattgctgcgtgttcatacccgccgatttagaagccggtaaaattttaggaagt
cttatttatagccctactttaatggctgttaaaggcaactacgaccaagtgaaccgttta
tgttcggaagttgccaacacccacggatggggatttgtaaatattaatttacgtccctat
tattccgaaggttccaaaacattaggttttgaagttgcagaacagttaggttgggaatta
ccagatcatattgtggctcctttggcaagcggttcgttgtttggcaaaatttataaagga
ttcaacgaatttaaagaagttggtttagtaaaagataaaaaggttcgattcagcggcgca
caagccgaaggatgttcccccatagctaaagcatttaaagaaggacgcgattttattcag
ccagaaaagcccaataccatcgcaaaatccattgccattggaaacccagcagatggaatt
tatgcagtagaaattgcgaacaaaaccaacggtaatatagaatcagtcaacgatacagaa
attatcgaaggcatgaagctgcttgcagaaaccgaaggtatatttacagaaactgctggt
ggtacaacaatcgcagtattaaagaaactggtggaagcaggaaaaattgacccagaagaa
accacagttgtttacattaccggcaacggcttaaaaacccaagaagctatacagggtgct
atcggcgaacctttgacaattgacgcaaaactcgatagttttgaatcagccctagaacgt
tctcgcaccctagaacgcttagagtggcagcaagtattagtttaa

DBGET integrated database retrieval system