KEGG   Rivularia sp. PCC 7116: Riv7116_3630Help
Entry
Riv7116_3630      CDS       T02364                                 

Definition
fatty-acid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:riv01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:riv01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4524759..4525595)
Genome map
AA seq 278 aa AA seqDB search
MTTRSAVTEGKQPLALSWTFTLFIGSIHVLALLAPWFFSWSALGVMIFLHWLFGSIGICL
GYHRILSHRSLQVPKWLEYIIAIIGAMAIQGGPIFWVAGHRLHHAHTEDEDKDPYSAKRG
FWWSHMLWMIYPVEEFFDYEQYKKYAPDLVRQPFYRWLNRYFILLQIPLVALLYALGGWS
FVIYGVVLRAVLLWHSTWLINSATHIRGYRTFDSEDNSRNLWWAAILTYGEGWHNNHHAH
PNVAKAGLRWWEIDMTWWAIKVLQSLGLAKKVVMPVNE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactacacgctcggctgttactgagggtaagcaaccgcttgctttgagttggactttt
acgttatttataggttcgattcatgttttagctttgttagctccctggtttttttcttgg
tctgctttgggagtaatgatatttttacattggctattcggcagtattggtatttgtttg
ggttatcacagaattttaagccatcgcagcttacaagtaccgaaatggctggaatatatc
attgccattatcggagcgatggcaattcagggaggtccaattttttgggtagccggacat
agattacaccatgctcacacagaggatgaagataaagatccttattctgccaagcgtggt
ttctggtggagtcatatgctgtggatgatctatcctgttgaggaattttttgactacgaa
cagtacaaaaaatatgctcccgatttagttcgccaaccattctatcgttggttaaatcgc
tactttatattgctgcaaatacccttggttgctttactgtatgctttaggcggatggtct
tttgtaatctatggtgtagttcttagagcagtattactttggcattccacttggttgatt
aattctgcgactcacatcagaggttatcgcacttttgactcagaagataattcccgcaat
ctttggtgggcagcgattttaacttatggtgaaggttggcacaataatcaccacgctcat
ccgaatgtagcaaaagctggattgcgttggtgggaaatagatatgacttggtgggctatt
aaagtattgcaaagtttgggattggctaagaaagtagtgatgccagttaatgagtaa

DBGET integrated database retrieval system