KEGG   Rivularia sp. PCC 7116: Riv7116_3756Help
Entry
Riv7116_3756      CDS       T02364                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Riv7116_3756
Enzymes [BR:riv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Riv7116_3756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4676507..4677064
Genome map
AA seq 185 aa AA seqDB search
MIKLYGGTFSRASIVHWYLEELEIPYEFIKLDMQAGEHRKPEFLAINPMGKVPAIVDGDY
ILWESGAILLYLADKYGKKTLSPQERGIYSQWSLFANATLGPGVFVEATRDKEMPKLMNP
LNEILGKQPFLLGNEFTVADVAVGSMLNYIPMMLKLDLSEYSNVTSYMKKLAERPAFQKV
MGSRG
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgataaaactctacggtggaaccttcagccgcgcttcaattgttcactggtatctagaa
gaattagaaattccctacgagttcatcaagctggatatgcaagcaggagaacaccgcaaa
cctgaattcctagcaatcaacccgatgggaaaagttccagcaattgtcgatggtgattat
atcctttgggaatccggcgcaatattgctatatcttgccgataaatacggtaaaaaaact
ctttctccccaagagcgcggtatttattctcagtggagcttgttcgcaaatgctactttg
ggacctggtgtttttgttgaagctacccgagataaagaaatgcctaaactaatgaatcct
ttgaatgaaatattaggcaaacaaccttttttattaggtaatgaatttaccgtcgctgat
gtagcggtaggttcgatgctcaactatattccaatgatgctcaagctggatttaagcgaa
tattcaaacgttaccagctacatgaagaaacttgccgaacgtccggcatttcaaaaggtt
atgggttcgaggggttaa

DBGET integrated database retrieval system