KEGG   Rivularia sp. PCC 7116: Riv7116_3848Help
Entry
Riv7116_3848      CDS       T02364                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Riv7116_3848
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Riv7116_3848
   00052 Galactose metabolism
    Riv7116_3848
   00500 Starch and sucrose metabolism
    Riv7116_3848
   00520 Amino sugar and nucleotide sugar metabolism
    Riv7116_3848
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Riv7116_3848
   00524 Butirosin and neomycin biosynthesis
    Riv7116_3848
Enzymes [BR:riv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Riv7116_3848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4791677..4792570)
Genome map
AA seq 297 aa AA seqDB search
MLTQVIGIDLGGTAIKLGRFTSDGSCLKSLSVHTPQPATPEAVVAAIVDAIARVDPEGNA
VAIGVGTPGPADAQGRIAKIAINLPQWRNIPLADTLEEKIGKPTIIDNDANCAGLGEAWL
GAGRFYKNFILLTLGTGVGGAIFIDGKLFTGKFGAAGELGLISVNPNGSQCKSGNRGSLE
QHTSVIAIRRRSGKEPAELGTLAKTGNKEALKFWQEYGKDLGIGVTSLIYVLTPEAVVIG
GGVSASFEFFLPSMKAEIEQRVMPTSRVNLQIVRAHLGNGAGMLGAAKLAIEKFINN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgctaactcaagtaattggtattgatctgggaggaacggcaatcaaattaggacgattt
acgtctgatggttcttgtttaaaatctttgagcgtgcatactccccaaccagcaacacca
gaagcggtagtggcagctattgttgatgcaatagccagagtagatccagaaggaaatgca
gttgcaatcggtgttggaactccaggcccagccgatgcccagggacgcattgctaaaatt
gcgattaatcttcctcaatggcggaacattcctttagcggacactttggaagagaaaatc
ggtaagcctacaattattgataatgatgcaaactgcgcgggtttgggtgaagcttggctt
ggtgcaggacgtttttataaaaattttattttactgactttaggtactggcgttggtgga
gctatttttattgatggtaaattatttacaggaaaatttggagccgcaggagaattaggc
ttaattagtgtaaatcctaatggttcgcaatgtaaaagcggtaatcgaggttctttggaa
cagcatacttcggtaatcgcaattcgtcgccgtagtggtaaagaaccggcagaattaggt
actttagctaaaactggaaataaagaagcgttgaagttttggcaggagtatggtaaggat
ttgggaattggagtcacaagtttaatttatgtgctaacacctgaagctgttgtaattgga
ggcggtgttagtgcaagtttcgagtttttcctaccgtcaatgaaagcagaaattgagcag
cgagtaatgcccacatctcgcgtaaatttacaaatagtaagggcgcacttaggtaatggc
gcgggaatgttgggtgctgcaaaactggcgattgaaaagtttatcaataattaa

DBGET integrated database retrieval system