KEGG   Rivularia sp. PCC 7116: Riv7116_3912Help
Entry
Riv7116_3912      CDS       T02364                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:riv00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:riv00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:riv02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4879780..4881126)
Genome map
AA seq 448 aa AA seqDB search
MLQINRKIIALTVLTVVALAGCNSSTSGNSTSDSTNQGNVIFIHPDGTSPSHWGAARMLH
YGPDSELNWDKMSNLGIYRGHLKDQLTATSNASAVIHATGVKANNDSFGLDENGQPLVAA
SDKPQTIMEEAVAAGKATAIINSGIIPEPGTGAFVAKTKTRSEFAEITKQIVNSGVDVIL
GGGEVFYLPKGTAGRYAKAEESQREDGLNLIEEAKKKGYTVVYTRDELLDLPADTKKVLG
IFAATDTYNDEPEENLKEKNLPLYVSGTPTVSQMLNATLKVVSQNANGFFIVLEEEGSDN
FCNFNNAKGCLEAVKRADDAIGVAMEFIDKNPDTLLITAADSDAGGLEVIGGTSELFPLD
KPLPEKGRNGAPWDGKDGTATPPFVSGPDKQGNNYPFAIAWSGIMDFTGSIVAKTHGLNA
DKLPNNVDNTDIYRLMYLTLFGKDIPQR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgctacaaattaacagaaaaataattgctttaacagtattgacagtagtggctttagct
ggatgtaactcatcgacatcgggcaattccacttcagattcaacaaatcaaggaaacgta
atattcattcatccagatggtaccagcccatctcattggggtgcggcgcgaatgctgcat
tatggcccggatagtgaacttaattgggacaaaatgtcaaacttgggtatttatcgaggg
catttgaaagatcaacttaccgcaacttctaatgcaagtgcggtaattcacgcaacagga
gttaaagccaataacgattcttttggattggatgaaaacggacaacccttggtagcggct
tccgataaaccgcaaacaattatggaagaagctgttgctgctggtaaagccacagcaatt
atcaattctggtattatacccgaacctggaactggtgcatttgtcgccaaaacaaagact
cgtagcgagtttgcagaaattaccaagcaaatagtaaactctggtgttgatgtcatttta
ggtggcggtgaagttttttatctacccaaaggtactgccggaagatacgcgaaagctgaa
gaaagtcagcgagaagacggattaaatttaatcgaagaagcgaaaaaaaagggttatacg
gtagtttatacccgcgacgaactcttagatttacccgcagacactaaaaaagtgttggga
atattcgccgcaaccgatacttataacgatgaaccagaagaaaatttaaaagagaaaaac
ttaccgctatacgtttcaggtaccccaacagtttcgcaaatgctaaatgcaactttaaaa
gttgtatcccaaaatgcaaatggcttttttattgttttagaagaagaaggaagtgacaat
ttttgtaatttcaacaacgctaaaggctgtttagaggcagtcaagcgagccgatgatgcc
ataggtgtggcaatggaatttatcgataaaaatcctgacaccttattaattaccgccgcc
gatagcgatgcgggaggattagaagtaattggaggcaccagcgaactttttcctttggat
aaacctttaccggaaaaaggaagaaacggcgctccttgggatggtaaagatggtacggca
actccacctttcgtttccggccccgacaagcaggggaataattacccctttgcgatcgcg
tggtcaggaatcatggattttactggttcgattgtggcaaaaacacatggattgaatgca
gataaattacccaacaatgtagataacacagatatttatcgcttgatgtatctaacctta
tttggaaaagacataccccaaaggtag

DBGET integrated database retrieval system