KEGG   Rivularia sp. PCC 7116: Riv7116_3957Help
Entry
Riv7116_3957      CDS       T02364                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:riv00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4934877..4935488)
Genome map
AA seq 203 aa AA seqDB search
METLRLYDFLPSGNGYKIRLLLKQIGMPFERIEINILKGESRTSEFLNKNLNGKIPVLEI
GEGKYLAESNAILMYLSEGTEFLPYDHYLKAQVLQWLFFEQYSHEPFIATSRYWISILGK
AEEYKQALKEKHQRGYAALEVMENHLTGKNFFVGERYTVADIALFAYTHVADEGGFDLSR
FKAIGAWLERIKAQPRFIGIKEG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgctgcgtttgtatgattttttaccttcagggaatggctataaaatacgtttg
ttattgaaacaaattggtatgccatttgaaagaattgaaatcaatatattgaaaggagaa
agtaggacttcggaatttttaaacaaaaatcttaacggtaaaataccagttttagaaatt
ggagaaggtaagtacctagcagaatcaaatgcaatattaatgtatctgagtgaggggaca
gaatttctcccctacgaccattatttaaaagcacaagtattgcaatggttattctttgaa
cagtatagtcatgagccatttatagctacatctagatactggatttctattttaggtaaa
gcagaagaatataaacaagcattaaaagaaaaacatcaacgcggttatgcagcacttgaa
gtaatggaaaatcatttaaccggaaaaaacttctttgttggagagcgctatacggttgct
gatattgctttatttgcttatacccatgttgcggatgaaggaggatttgatttaagtaga
tttaaagctatcggggcttggctcgaaagaattaaagcgcaaccgagatttattggtatt
aaagaagggtaa

DBGET integrated database retrieval system