KEGG   Rivularia sp. PCC 7116: Riv7116_4161Help
Entry
Riv7116_4161      CDS       T02364                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:riv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5214723..5216759)
Genome map
AA seq 678 aa AA seqDB search
MAASTVNSSFTTFPLTAVVGQEAIKLALLLAAVDPELGGVAIAGRRGTAKSVMARAIHAL
LPPIEVVKDSISNCNPDNPEEWDDDLLSRGVKSTEDVETEIIPAPFLQIPLGVTEDRLLG
SVDVEKSVKQGDTVFQPGLLAAANRGVLYVDEINLLDEQISNQLLSVLSEGRNQIEREGI
SFQHPCKPLFIATYNPEEGDLREHLLDRIAISLSADGILGLDDRVQAVEQAIAYSRSPQE
FLQQYNDDIDSIKTQIVLAREWLKEVTISEEQITYLVEEAIRGVVQGHRAELFAVRVAKA
SAALDGRNQVNPEDLRRAVELVIVPRATVIQTPPEEEQQPPPPPPQQSQEEPEDESEQEQ
EEQEEQEEDDSNQEEQEPPGIPEEFIFDPEGVILDESVLYFAQTAQRQGNSGSRGLIFSD
DRGRYIKPMLPKGKVRRIAVDATLRAAAPYQKARRQRNPGRNVIVEQGDIRAKRLARKAG
ALVIFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVALIPFRGEQAEVMLPPTRSIT
LARTRLEKMPCGGGSPLAHGLTQAAHVGLNAQRSGDIGQVVIVAITDGRGNIPLSRSLGE
PQEPGEKPDIKGELLEVAAKIRALGIQLLVIDTESKFVSTGFAKELAKNAGGKYYHLPKA
TDKAIAAMTKGAIADLRM
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatccactgttaattctagttttactacctttcccttaaccgctgtagttggt
caagaagcgattaaattagctttactattggcagctgtcgatccagaattggggggagta
gcgatcgccggacgtagaggaacggcaaagtcagtgatggcgagggctatccacgcttta
ctaccgccgattgaagttgtcaaagattctattagtaactgcaatcccgataatccagaa
gaatgggatgatgatttattatctagaggcgttaaatctacagaagatgtagaaaccgaa
attatccccgcgccatttttacaaatacctttaggagtcaccgaagatagacttttgggt
tcggtggatgtagaaaaatctgtgaagcaaggggatacggtatttcaaccgggtttactc
gcagcagcaaatcgcggcgtgctgtatgtagatgaaatcaatcttttagatgagcagatt
agcaatcaacttttaagcgtactatctgaagggcgcaatcaaatcgaacgggaaggaatc
agttttcaacatccttgcaaaccgttatttatcgctacctacaatcctgaagaaggagat
ttacgcgaacatttattagacagaattgccatttccctttccgcagacggcattttagga
ttagacgatagagtccaagcagtagagcaagcaattgcttattctcgctctcctcaagaa
tttctccagcagtacaacgatgatattgactcgataaaaactcaaattgttttggctagg
gaatggttgaaagaagttaccatcagcgaagaacaaattacttacctagttgaagaagca
attcgtggtgtagtacaaggacatcgtgccgaattatttgcggtacgggtagcaaaagca
tccgcagccctcgacggacgcaatcaagttaaccccgaagacttgcgtcgtgcagtggag
ttagttatagtaccccgcgcaaccgtaattcaaacaccacccgaagaagaacagcagcca
ccaccgccaccaccacaacaaagccaagaagaaccagaagacgaatccgaacaagagcaa
gaagagcaggaagagcaagaagaagacgattctaaccaagaagaacaggagccaccaggt
attcccgaagaattcatcttcgatccagaaggtgtaatcttagatgaaagcgtgctttac
tttgctcaaacagcccagcgtcaaggaaactccggaagtcgcggtttaatattttccgat
gacaggggacgctacatcaagccaatgctacccaaaggaaaagttcgtcgcattgccgta
gatgccaccttacgagccgcagcaccatatcaaaaagcacgacgacaacgaaatcccggt
agaaacgtcatcgtagagcaaggggatattcgtgcaaaaagattggcgaggaaagccgga
gcattagtaatattcgtagtagacgcttccggttcaatggcacttaaccgaatgcagtca
gccaaaggagcggtaatgcaattattaacagaagcatatcaaaaccgcgaccaagtagcc
ttaattcccttccgaggagaacaagcagaagtaatgttaccacccacacgttccattaca
ttagctcgtacccgcttagaaaaaatgccttgcggtggcggttcacccttagcccacggt
ttaacccaagccgcccacgtcggtttaaacgcccaaagaagcggcgacatcggacaagta
gtcatagtagccatcaccgacggacgcggtaacataccattatctcgttcgttgggagaa
ccccaagagccaggagaaaagccagatatcaaaggggaattattagaagtagccgctaaa
atccgcgctttaggaattcaattgttagtaatcgacaccgaaagtaaattcgtttctacg
ggatttgcgaaagagttagctaagaacgctggaggtaaatattatcatttgcccaaagct
acagataaagccattgcagcaatgacgaaaggtgcgatcgcagatttaagaatgtga

DBGET integrated database retrieval system