KEGG   Rivularia sp. PCC 7116: Riv7116_4185Help
Entry
Riv7116_4185      CDS       T02364                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Riv7116_4185
Enzymes [BR:riv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Riv7116_4185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5244174..5245466
Genome map
AA seq 430 aa AA seqDB search
MLLRPHTMRILYKLKRSIFKPLARVVWKLFCNIFKIDINSRKSKKLILQGLLFSLLCISL
SLFFIQFINIFQVNTSIAATTIVPPLSAKKSQIVDNTGKVVVLRGINWFGMEVDTHAPHG
LWVRDYKQMLAHIKSLGYNIIRLPYSVEAMKSSHISGVDFSIGANSELHGKTPLEVMDLV
IQEAHRQGLLILLDSHCLKDGHISEVWYGDGFTEEDWINTWILLAKRYKNQPNVIGADLK
NEPHGRASWGTDDTSTDWRLAVQKAGDKILDINPDWLIVVEGIEKNVPNQIQHGYFWGAN
LEGVREYPVHLKKPSKLVYSPHEYGGSKVSWFQEPDFPKNLYQRWEIGFNYIHRKNIAPI
LVGEFGGYHVDRKSKEGIWQRKFVDYIAQNKLSFAYWCWNPNSKGTGGVLQDDWRTVNDS
KQALLNKILP
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttcgacctcacactatgcgaattctatataaattaaaacgtagtatattcaag
cctttagcacgagttgtatggaagctattttgcaatatatttaaaatcgatattaattcc
agaaagtcgaaaaaacttattctccaaggcttattgtttagtttgctttgcataagctta
agtctgttttttatccaatttatcaatatttttcaagttaatacttctatcgcagctact
accatcgtgcctcccttatcagcaaaaaaatctcagattgttgataatacgggtaaagta
gtcgtactgcgtggtatcaactggtttggcatggaagttgatacccatgcacctcatggt
ttatgggttagagactataagcaaatgctcgctcatataaaaagcttgggctataacata
attcgcttgccttattctgtggaagcgatgaaatcttcacacattagtggtgttgatttt
tctattggtgcaaattcagaacttcatggaaaaactcctttagaagttatggatttagtt
atccaggaagcgcacagacagggattattaatcttattagatagtcattgtctcaaggat
ggacatatttcagaagtttggtatggagatggttttacagaagaggattggataaatacc
tggattcttttggctaaacgctataaaaatcaacctaatgttatcggtgcagatttgaaa
aacgaaccccacgggcgggcaagttggggaaccgatgatacttcaactgattggcgttta
gctgttcaaaaggctggagacaagattcttgatattaatcctgactggttgattgtagta
gagggtatagaaaaaaacgtacccaatcaaatacagcatggttacttttggggtgcaaat
ttagaaggtgttcgggaatatcccgtgcatctaaaaaaacctagtaaactggtgtactct
cctcacgaatacggtggttcaaaagtttcctggtttcaagaaccagattttcccaaaaat
ctttaccagcgttgggaaataggatttaactacattcatagaaaaaatattgctcccatt
ctcgttggtgaatttggagggtatcacgtcgatcgcaaatctaaagaaggcatttggcag
cgaaagtttgtagattatattgcccaaaacaaactgagctttgcttattggtgttggaat
cccaacagtaaaggtaccggaggtgtattgcaagatgattggcgaacagtaaatgattca
aaacaagcgctattgaacaaaatattaccttaa

DBGET integrated database retrieval system