KEGG   Rivularia sp. PCC 7116: Riv7116_4347Help
Entry
Riv7116_4347      CDS       T02364                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Riv7116_4347
Enzymes [BR:riv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Riv7116_4347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5448845..5449786
Genome map
AA seq 313 aa AA seqDB search
MRSYTLTAPAKINLYLEIIGDRPDGYHELAMIMQSIGLADQIEIEANDVQLIRFRCDSKE
VPVDRSNLVYRAADLMVQEFPDSFATYGGVDITLHKHIPVAAGLAGGSTDAAAVLVGIDL
LWKLGLTKLELEELAAKIGSDIPFCIGGGTAIATGRGEILSPLLGLHNTYIVLAKYRSLE
VSTPWAYKTYRSLYSDSYVTDKESLSARANAVHSGEIVKAISHQNASEVAQKMHNDLEKV
VLPEYPQVLQLKESFAKYDILGTMMSGSGPSVFALCDSKDKAEEVKLHMRNEIPSDDLEL
FVTQLINYGIQVR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagctataccttaactgctccagccaaaattaacttatacttggaaatcatcggc
gatcgcccggatgggtatcatgagttggctatgataatgcagagtataggactcgcagac
caaattgaaatcgaagccaatgacgtacagttaattaggtttaggtgtgatagtaaagaa
gttcctgtagataggagtaatttagtttatcgtgctgcggatttaatggttcaggaattt
cccgatagttttgctacttatgggggcgtagatataacgcttcacaaacacatccccgta
gctgctggtttagctggaggttcgacagatgcagcagcagttttagttggtattgattta
ttgtggaaattgggattaactaaattagagctagaagaattagccgcgaaaattggttct
gatataccattttgtatcggaggaggaaccgcgatcgcaacaggtagaggtgaaatactt
tctccactattgggtttgcacaatacatatatagtattggctaaatatcgcagtctagaa
gtttctactccctgggcttataaaacctatcgttccttgtatagtgatagctatgttaca
gataaagaaagtttgagtgcccgtgcaaatgcggtacattcaggagaaatagtcaaagcg
atttcgcatcaaaacgcttctgaagtagctcaaaaaatgcataatgatttagagaaagta
gtattaccagaatatcctcaagtattgcagttaaaagaaagttttgccaaatacgatatt
ttaggaacaatgatgtccggtagtggtccaagtgtatttgctttgtgtgattctaaagat
aaagcagaagaagtaaaactgcatatgagaaacgaaatcccttcagatgatttagaactt
ttcgtcacccaattgataaattatgggattcaggtaagatag

DBGET integrated database retrieval system