KEGG   Rivularia sp. PCC 7116: Riv7116_4347Help
Entry
Riv7116_4347      CDS       T02364                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00900  Terpenoid backbone biosynthesis
riv01100  Metabolic pathways
riv01110  Biosynthesis of secondary metabolites
riv01130  Biosynthesis of antibiotics
Module
riv_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Riv7116_4347
Enzymes [BR:riv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Riv7116_4347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N YpjP
Motif
Other DBs
NCBI-ProteinID: AFY56774
UniProt: K9RHH4
Position
5448845..5449786
Genome map
AA seq 313 aa AA seqDB search
MRSYTLTAPAKINLYLEIIGDRPDGYHELAMIMQSIGLADQIEIEANDVQLIRFRCDSKE
VPVDRSNLVYRAADLMVQEFPDSFATYGGVDITLHKHIPVAAGLAGGSTDAAAVLVGIDL
LWKLGLTKLELEELAAKIGSDIPFCIGGGTAIATGRGEILSPLLGLHNTYIVLAKYRSLE
VSTPWAYKTYRSLYSDSYVTDKESLSARANAVHSGEIVKAISHQNASEVAQKMHNDLEKV
VLPEYPQVLQLKESFAKYDILGTMMSGSGPSVFALCDSKDKAEEVKLHMRNEIPSDDLEL
FVTQLINYGIQVR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagctataccttaactgctccagccaaaattaacttatacttggaaatcatcggc
gatcgcccggatgggtatcatgagttggctatgataatgcagagtataggactcgcagac
caaattgaaatcgaagccaatgacgtacagttaattaggtttaggtgtgatagtaaagaa
gttcctgtagataggagtaatttagtttatcgtgctgcggatttaatggttcaggaattt
cccgatagttttgctacttatgggggcgtagatataacgcttcacaaacacatccccgta
gctgctggtttagctggaggttcgacagatgcagcagcagttttagttggtattgattta
ttgtggaaattgggattaactaaattagagctagaagaattagccgcgaaaattggttct
gatataccattttgtatcggaggaggaaccgcgatcgcaacaggtagaggtgaaatactt
tctccactattgggtttgcacaatacatatatagtattggctaaatatcgcagtctagaa
gtttctactccctgggcttataaaacctatcgttccttgtatagtgatagctatgttaca
gataaagaaagtttgagtgcccgtgcaaatgcggtacattcaggagaaatagtcaaagcg
atttcgcatcaaaacgcttctgaagtagctcaaaaaatgcataatgatttagagaaagta
gtattaccagaatatcctcaagtattgcagttaaaagaaagttttgccaaatacgatatt
ttaggaacaatgatgtccggtagtggtccaagtgtatttgctttgtgtgattctaaagat
aaagcagaagaagtaaaactgcatatgagaaacgaaatcccttcagatgatttagaactt
ttcgtcacccaattgataaattatgggattcaggtaagatag

DBGET integrated database retrieval system