KEGG   Rivularia sp. PCC 7116: Riv7116_4452Help
Entry
Riv7116_4452      CDS       T02364                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
riv  Rivularia sp. PCC 7116
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5581410..5582558
Genome map
AA seq 382 aa AA seqDB search
MVLNLLNQLVSELKELGAIQSIEVEKAFSKVLRHKLLETFYLPRDLQQPIEHKSSNPDSE
HLKLIYSNNSLVTRISNGFPSSSTSEPLLMARMIELLALSPNLKVLEVGTGTGYNSALIS
EIVGNQNLVVSVDIQEDVIAQTKRLLSNAGYPNINLVLRDGFYGVEEEAPYDRIIATVGC
FDISPHWVNQLSTSGLMILPLHHGGWTPLVKIWQQEDRLKGKVVGISGFMPFKGDEFADE
PAPFGFMNSVPIEEFEELPLFDNLEVEHTNNFLMWSAFPVNFYYFITISDSRAFWDIKPP
GYGLYDKQEGIILISPQKNCIFFKGNRKLYNRLQKLYENWLELGKPSAFDYEIEFQPSPK
AATSSKKGWNIKRKFYHQFLSL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggtattaaatcttttaaatcaattggtaagtgaattaaaagaactaggtgccatacaa
tctattgaggtggaaaaggcatttagcaaagttttacgtcataaattactagaaactttt
tatcttcccagggatttacaacaaccaattgaacataaatcaagtaatccagattcggaa
catttaaagctgatttactctaataattctcttgttactcgtataagtaatggtttccca
tcaagttcaacatccgaacctttgttaatggctcgtatgattgaattgctggcgctctct
cccaatcttaaagtgttagaagttggcacaggtacgggttataattctgcactgatatcg
gaaatagttggcaatcaaaatctagttgtctcggtagatattcaagaggatgtcattgct
caaactaaaagattactgtctaatgcaggctatccaaatattaatttagtgttgcgcgat
ggcttttacggtgtcgaagaagaagcaccatacgatagaattattgcaactgttgggtgt
tttgatatttcacctcactgggtaaatcagctttcgacttctggtttaatgatattaccg
ttacatcatggaggttggactcctttagtcaaaatttggcagcaagaagacaggctaaaa
ggtaaagtagttggtatttctggttttatgccttttaaaggagatgaatttgcggatgaa
cctgcaccttttggttttatgaattcggttcctattgaagagtttgaggaactcccctta
tttgataacctcgaagttgagcataccaacaactttcttatgtggtctgctttcccagtt
aatttctattattttattacaatatccgattcccgtgctttttgggatatcaaacctccg
ggatatggtttgtatgataaacaagaaggaataattctgattagtccgcaaaaaaactgt
atatttttcaaaggtaatagaaaactctacaatagattacagaaactatacgaaaactgg
ttagagttaggtaaaccaagtgcttttgattatgaaattgagtttcaaccatcaccaaaa
gcagcaacatcttctaaaaagggatggaatattaaacgaaagttctaccatcagtttttg
tctctataa

DBGET integrated database retrieval system