KEGG   Rivularia sp. PCC 7116: Riv7116_4501Help
Entry
Riv7116_4501      CDS       T02364                                 

Definition
choline dehydrogenase-like flavoprotein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
riv  Rivularia sp. PCC 7116
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Riv7116_4501
Enzymes [BR:riv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Riv7116_4501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5644074..5645633)
Genome map
AA seq 519 aa AA seqDB search
MHPKFKRRQFLQATLAATASIGYYNIATFAEGSEERVEAVVIGSGFGGAVASLRLAEAGI
ETVVLERGRRWPISTAGDTFSTYDKPDGRSTWLSPTTIIFGETPIDVYTGVLDIKKGDGV
NVLRGAGVGGGSLVYNAVTYQPTEELFYRAFSRSINYEELDRVYYPRVRSILKPSPIPDD
ILQSPFYLTSRIVLEQAAKANLKARKLDMNVDWDIVRQEIAGTKVPSAIDGQVYYGINSG
AKQSLDRNYLSMAEATGFVEIRPLHVVIDIEEASRGRFRIRSNKIDEQGNVVEKKTIVCK
YLFLAAGSIGTTELLLRAKNNGKLRRINNQVGKRWGTNGDILASVLTSMQTNPTKGGPAA
TVIEDFDNPIAPLVFEQIPFPNVPEGVYTGVSLAITKPEGSLNYNASTKTADLVWPQNSA
NNQKIKKANLDFFQRLNQANGTTLAVEPDASITAHPLGGATIGAVCSPYGRVRGYRNLFV
VDGAFIPGSTACTNPSLTIAALAERNLDRFLNRYRKRDY
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcatcctaaatttaagcgtcgtcagttccttcaagcaactcttgcggctactgcaagt
atcggttattacaacatcgcgacttttgctgaaggctcggaagaacgtgtagaggctgtg
gttattggtagcggttttggtggagcggtagcttccttaaggcttgctgaagcggggatt
gagacggttgtactggagcgcggacgacgatggcccataagtacggcaggtgatactttt
tctacctatgataaacccgatggtcgttctacttggttgagtccaactacaatcatattt
ggagaaactcctattgatgtatacacaggagttctggatatcaagaaaggtgatggggtt
aacgttttgcggggagcgggggtaggtggtggctcccttgtatataacgcagtaacctat
cagcctactgaagaacttttttatagagctttttctcggagcataaattacgaagaactc
gatagagtttattatccaagggtgcgttcgattctgaaaccttcccccatacccgatgat
atcctgcaaagtccattttatttaaccagtcgtatagttttggaacaagcagcgaaagct
aatttaaaagcccgcaagcttgatatgaatgtggattgggatattgttcggcaggagatt
gctggaacaaaagttccttctgctatcgacggtcaagtatactatggcatcaacagtgga
gcaaaacagagcttagaccgcaattatctttcgatggctgaggctactggcttcgttgag
atacgacctctgcatgtcgttattgacatagaagaagcaagtcgcggacgttttcgcatc
agaagcaataaaatcgacgagcaaggaaatgtagttgagaaaaaaactattgtttgtaaa
tatctatttttagcagctggttctattggaaccacagaacttttattacgtgctaaaaat
aatggaaaattgcgccgtattaataaccaagtaggaaaaagatgggggactaatggagat
atacttgcttctgttcttacttcaatgcaaaccaatcctacaaaggggggacctgcggct
acagtaattgaggacttcgacaaccctatagcccctttggtatttgaacaaatacctttt
cctaatgttcctgaaggcgtttatactggtgtgagtcttgctattaccaagccggagggt
tctttaaactataatgcttctaccaaaacagccgatttagtttggcctcagaactctgct
aacaatcagaaaattaaaaaggctaatttagattttttccaacggctaaaccaagctaac
ggcacaactttagctgttgaaccagatgctagcattaccgctcatccccttggtggtgca
acaattggcgctgtatgcagtccttatggacgagttcgcggttatcgtaatttgtttgtc
gttgatggtgcttttattccaggttctacagcctgtaccaacccttcccttaccatcgcg
gctttagcggagcgtaatctggatagatttcttaacagataccgcaaacgcgattattaa

DBGET integrated database retrieval system