KEGG   Rivularia sp. PCC 7116: Riv7116_4569Help
Entry
Riv7116_4569      CDS       T02364                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Riv7116_4569
   00052 Galactose metabolism
    Riv7116_4569
   00500 Starch and sucrose metabolism
    Riv7116_4569
   00520 Amino sugar and nucleotide sugar metabolism
    Riv7116_4569
Enzymes [BR:riv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Riv7116_4569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5726584..5727459
Genome map
AA seq 291 aa AA seqDB search
MKNQIKKAVIPAAGFGTRLFPATKVVKKELFPVIDKDGRAKPVIQSIVEEAVNAGIEEIG
IVTQPDDRDVFESYFNNSPQSKLFNKLSQQNQEYCKYLQDLGSKITFLAQDKQEGYGHAV
FCAKEWVGNEPFLLMLGDHIYSSDAEKSCAFQVLRAYEQVSHSVIGLNSLPEEMIHKAGC
ITGVWQEKKSILKVTQVFEKPTIEYARKNLRVEGMADNEFLCIFGLYALTPKIFDFLEEH
INTDFREKGEFQLTSCLEKLRQAEGMTGLVVDGKTFDIGMPNVYRQTMIDF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcaaattaaaaaagctgtaattcctgctgctggttttggtactcgtttattt
ccagcaacgaaagttgtaaaaaaggaattgtttccggtaattgataaggatggtagagct
aaaccggtaattcagtcgattgtagaggaagctgtgaatgcggggatagaagaaattgga
attgtaacgcaaccggatgatagagatgtttttgaaagttattttaacaactcaccacaa
tctaaactttttaacaagctttcacagcaaaatcaggaatattgtaaatatcttcaggat
ttaggtagtaaaattacatttttagcacaggacaaacaagaaggttacggacatgcagtt
ttttgtgccaaggaatgggtgggtaatgaaccttttttgttaatgttaggagaccatatc
tattcgtctgatgccgaaaaatcctgtgcttttcaagttttacgggcttacgaacaagtt
agtcacagtgttattggattgaattctttaccagaggaaatgattcataaggctggatgt
attacgggagtttggcaagaaaaaaaatcgattttaaaagttacgcaagtttttgaaaag
cctactattgaatatgcccggaaaaatttacgagtggaaggaatggctgacaatgaattt
ttatgtatatttggcttatatgcgctaacgccgaaaatatttgattttttagaggagcat
attaatactgattttcgagagaagggcgagtttcagttgacatcttgcttagaaaaacta
aggcaagctgagggaatgactggtttggttgttgatggcaaaacttttgatattggaatg
ccaaatgtttatcggcagacaatgattgatttttaa

DBGET integrated database retrieval system