KEGG   Rivularia sp. PCC 7116: Riv7116_5109Help
Entry
Riv7116_5109      CDS       T02364                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Riv7116_5109
Enzymes [BR:riv01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Riv7116_5109
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Riv7116_5109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6392475..6393020)
Genome map
AA seq 181 aa AA seqDB search
MAILKLEDGTVYTDLQSISQELAPLNVQLDYWAIGEDGQINQKLTKASLDDSEKEEVLKG
LDKYFEQLKQEAGYQERDLIVLHPEIPNLDDMLKKFDSIHTHADDEVRYIVDGEGIFGFV
RPDGSQVELTIQPQEYINVPAGCEHWFYLTPARRIKAVRYFIGKEGWVPEYTGREKVIGN
W
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcaattctgaaattagaagatggtacagtttatacagatttgcaatctattagccaa
gaattagccccattaaacgttcaacttgattattgggcgattggagaagatgggcagata
aatcaaaagctgacaaaagcaagtttggatgatagtgaaaaagaagaagtattgaaaggt
ttagataagtatttcgagcagctaaagcaagaagcaggctatcaagaaagggacttgata
gttttgcatccggaaataccaaatttagatgacatgttgaaaaaatttgatagcatacac
actcatgcagatgatgaagtacgctacatcgtagatggagaaggaattttcggttttgtg
cgtcccgacggcagccaagtagaactaacaatacagccacaagaatacattaacgttcct
gccggttgcgagcattggttttatttaacacctgcacgtcggattaaagcagtgcgttat
ttcattggtaaggaaggctgggttcctgaatatacgggaagggaaaaggtaattggtaat
tggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system