KEGG   Rivularia sp. PCC 7116: Riv7116_5330Help
Entry
Riv7116_5330      CDS       T02364                                 

Definition
arginase family hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:riv00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6686094..6687128
Genome map
AA seq 344 aa AA seqDB search
MNNPIQNYNPSDVGQINGNIFGLPFDYTTANLIIIPVPWEVTVSYGAGTANAPQRILDAS
PQLDLFDFDNPDGWKQGIFMMEIPQDILDKNKYYRQQAATIIQRLEKGKPLTDAPNLTSL
LTEINQTCENVNQWLFDECHQAINDGKTVAVIGGDHASPLGYMQTLANNYSSYGILHIDA
HADLRNAYEGFEFSHASIMYNAMKLPQISKLVQVGLRDICQDEVETINQSNNRIVAYYDP
IIKQKLYSGTTWIDLCKEIVSNLPEYVYISFDADGLDPKLCSNTGTPVPGGLELEQAFCL
IREVVNSGRKIIGFDVCEVGDAEWDGNVGARVVLKLAYLMDLSQ
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacccaattcaaaactataaccccagcgatgtcggacaaataaacggtaatatc
tttggtttacccttcgattacactaccgcaaatttaatcattattcccgtaccttgggaa
gtcacggtttcttatggtgctggtacagctaacgcacctcaaagaattctcgatgcttca
ccacagttagatttatttgattttgataatcccgatgggtggaagcagggaatttttatg
atggaaatacctcaagatattttagataaaaataagtattaccgacagcaagcagcaaca
attattcaacgattagaaaaaggtaaaccattaacagatgcacctaatttaacatcgcta
cttacggaaattaaccagacttgtgaaaatgtaaatcagtggttattcgatgaatgtcac
caagcaattaacgatggtaaaaccgttgcagtcattggtggcgaccatgcttcacctttg
ggttatatgcagactttagcaaataattattcaagctatggcattttacacatcgatgct
catgccgatttacgtaatgcttatgaaggttttgaattttctcatgcttcgattatgtac
aacgcgatgaaattaccgcaaatttcaaagttagttcaagttggtttgcgagatatttgt
caggatgaagttgaaactattaaccaatccaacaatagaatagttgcttattacgaccca
attattaaacaaaagctgtattctggaactacttggattgatttatgtaaggaaattgtt
agtaatttacccgaatacgtttatattagctttgatgccgatggtttagaccccaaacta
tgttcaaatactggaactccggttcctggaggtttggaattggagcaagctttttgtttg
attagagaagtagtaaacagcggtagaaaaattattggttttgacgtttgtgaggttggt
gatgctgaatgggatgggaatgttggcgcgagagtggttttgaaattggcttatttgatg
gatttatcgcagtaa

DBGET integrated database retrieval system