KEGG   Rivularia sp. PCC 7116: Riv7116_5437Help
Entry
Riv7116_5437      CDS       T02364                                 

Definition
(GenBank) endoglucanase Y
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
riv  Rivularia sp. PCC 7116
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
6827015..6828271
Genome map
AA seq 418 aa AA seqDB search
MMRYLPLIAAIVSQIGLYSCNSGSSAVNFPSQNQQTPMPSFTPLSTDDNYDVFLAALPKE
TQNRELLAKSWSSYRRLFIQSDGRVIDFQAKDRSTSEGQAYAMLRAVLIDDATTFAKTLN
WAENNLQRQQNDSLWAWKWGRRKDGSWGTIDSNFASDADIDAITALIFAYRKWQNPQYLE
LARIKLQDLWKLSTFTDSSEKRYLLPGPSDAFVPNSSTIYLNPSYLAPYAFRIFAQVDPE
RDWLSLVDSSYQVLEKSLGLSGVGLPSDWVALNLETEEFFALPAQSNIQTVYSFDAYRIW
WRIALDATWFNSSQAKSYLQKSTQHLQKEWRQKSYLLASIDLKGKPLVDYEATSQYAMFH
VAMRLLKPGIAQEILVKKILPKYQKGTWGDRSGYYTQNLVWLSLFNPSDVPQKLIQKE
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgatatttgccattaatagcggcgatagttagccaaatcggcttgtactcttgc
aactctggttcttcagcagtcaactttcccagccagaaccagcaaactccgatgccttca
tttactccattgtcaactgacgataattacgacgtatttcttgcagccttaccaaaagaa
actcaaaatcgggaattattagcaaaaagttggagcagctatcgccggttatttatacag
agcgatggacgagtaattgattttcaagctaaagatagatctaccagcgaaggtcaagct
tatgccatgctcagagcagttttaatcgatgatgccacaacttttgccaaaactttaaac
tgggcagagaataatctgcaacggcaacagaatgatagtctgtgggcttggaaatgggga
agaaggaaagatggtagttggggcactatcgacagtaactttgctagcgatgcagatatt
gatgcgataacagccttgatttttgcttatagaaaatggcaaaatcctcaatatctagaa
ttagctcggataaaattacaggacttgtggaaactgtctacttttactgatagtagcgag
aaacgctatttactaccaggtcctagcgatgcgtttgttcccaattcatctactatttat
cttaatccttcctacctggctccctatgcttttcggatttttgctcaagtcgatccagaa
cgtgattggttgagcttagtagatagtagttatcaggtgctggagaaatcattagggctt
tctggtgtgggcttgcctagcgactgggtagcattaaatctagaaacagaagaatttttc
gccctccccgcacaaagcaatattcaaactgtatacagttttgatgcttaccgcatttgg
tggcgaatcgctcttgatgctacatggtttaattcatcccaagcaaaaagctatctccaa
aaatctacccaacatcttcaaaaagaatggcggcaaaaatcttacttacttgcaagcatt
gatttaaaaggaaagccattagtagattacgaagcaacgtcacaatacgcaatgtttcat
gtggctatgaggcttttaaaacctggtatagctcaagaaatattagtaaaaaaaatatta
cctaagtatcaaaaaggaacttggggagaccgttcgggttactacacccaaaacttggtt
tggttgagcttattcaatccttcagatgtaccccaaaaattaattcagaaggaataa

DBGET integrated database retrieval system