KEGG   Rivularia sp. PCC 7116: Riv7116_6339Help
Entry
Riv7116_6339      CDS       T02364                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Riv7116_6339
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Riv7116_6339
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Riv7116_6339
Enzymes [BR:riv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Riv7116_6339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8032402..8034837
Genome map
AA seq 811 aa AA seqDB search
MPSTQTIIKFDDIFYLKHKNGKYLVSVDKGRYNFPRLDNTGKVKLQLKGRNSSDNLKDGD
TVNIRSLEASLGENNILGAFSDSHNCYYWKDNYDKEKQGWRIHKASGDKDVIRYGDEVYF
TNVSYKNQRLVADTRYDGFLTTKKNVTDTWIIESVQKKQPANESNNNKSASVFGLSVASG
DPSATGVILWTRINPEKYDTKKPLKYQVCESNKFDNCVIDEEVKAHFGEDTDYTVHVDLD
GKLESGKTYFYRFHYDGVYSKTGRCKTLPRQNENIPSLRLAVITCNDYSTGYFNAFYYLA
EEDIDYVIHLGDFVYEYSQYPKGYGKVHREDIKWENDPYGQPYADSKTQRATSLEHFQQI
YRTYRQDLALQAAMEQHTWMITLDDHEVADNWYWDYDKKTIEVGSDHPIFKKYKEQEEVE
KVKKEIESLELKEEENKILKVLAALEALKIEEVEKRIKEIKSLEKKELEKIFKALEPLKP
LQKARSEEMKNLYNNAIKAWRNYVPIKPLNNNAELHESSIYRQFSFGKLVDFFLTDSRSY
RSKPRPDLGADDKENTHTTMLGQRQKEWLTEGVKNSKATWKVWGNQTLLATSSINSTAAK
LKGEPELIDDWQAYMGERQSILQTIKDSETKNHDDNNKKSNFVVFTGDMHTSMISYLRTD
FEGTLNKANMDYSKIAGVEFMTPSLTSPGVSEGLREEITKIPGASTIGQVIDMLPNIFSS
DSSDDAGEGSTLHGLTAGLNRFNTYIKHYDSSINGYAIAEFTSSELIWKVYAINKSDCDV
ADDGSTISKKGVNKHLAKTMKYDPSTINLDD
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaactcaaactataatcaaatttgacgatatcttttatctcaaacataagaac
ggtaaatacttggtatccgtagataaaggacgatacaattttcctcgattagataatacg
ggtaaagttaaactgcaacttaaaggcagaaacagtagtgacaatctcaaagacggtgat
acggtgaacatccgttctttggaagctagtttaggtgaaaataatattttaggtgctttt
tcagacagccacaattgctattactggaaagataattacgacaaagaaaagcaaggttgg
cgaattcacaaggcttctggtgacaaagacgtgattcgctacggagatgaagtttatttt
actaacgtctcttataaaaatcaaagacttgtagccgatactagatacgatggcttttta
actactaagaaaaatgtaactgatacgtggattattgaaagtgtccagaaaaagcaacct
gcaaatgaatccaataacaacaaatctgcttctgtatttggtttatcagtagcatcggga
gatccatcagctacaggtgtaattctttggactcgaattaatccagaaaagtacgatact
aaaaagcctttaaagtatcaggtttgtgaaagcaataagtttgataattgcgtaattgac
gaagaagttaaagcacactttggagaggacacagattatacagttcatgtcgatttagat
ggcaaattagaatcgggtaaaacttatttttatcgctttcattacgacggagtatatagt
aaaactggtcgttgtaaaacgctaccaagacaaaatgaaaatattcccagtcttcgtcta
gcagtgataacttgtaacgattacagcactggttatttcaatgctttctattatctagca
gaagaagatatagactacgtgattcacctaggggattttgtatatgaatattcacaatat
cccaaaggttacggaaaagttcaccgtgaagatattaaatgggaaaacgacccttatggt
caaccctacgctgattcaaaaacccaaagagccacatcattagaacatttccagcagatt
tatcgtacttatcgtcaagatttagcgcttcaagctgcgatggaacaacatacctggatg
ataactttagatgaccatgaagttgctgataactggtattgggattacgacaagaaaact
atagaagtaggtagcgaccatcctatctttaaaaagtataaagagcaagaagaagttgaa
aaagtaaaaaaagaaatcgaatcactagaattaaaagaagaagaaaataaaatactcaaa
gtactcgcagcactcgaagcactaaaaatagaagaagtagaaaaaagaatcaaagaaatc
aaatcactagaaaaaaaagaactagaaaaaatattcaaagcactagaaccactaaaacca
ctgcaaaaagcacgaagcgaagagatgaagaatctctataacaatgctattaaagcttgg
cgaaattacgttcctattaaaccacttaacaacaatgctgaactccacgaaagctcaatt
tacagacagttcagcttcggtaaattagtagattttttcctaactgatagccgtagttac
agaagtaaaccacgaccagacttaggtgcagatgacaaagaaaatactcacacaactatg
ttaggtcaaaggcaaaaagaatggttaaccgaaggagttaaaaattcaaaagctacttgg
aaagtgtggggtaatcaaacacttttagcaacttcatcaataaattcaacagcagcaaag
cttaaaggagagccagagttaattgatgattggcaagcatatatgggggaacgtcagtct
attttacaaacgatcaaagacagcgaaaccaaaaaccacgacgataacaataaaaaaagt
aatttcgtggtattcaccggggatatgcacacttcgatgatttcttatctaagaactgac
tttgaagggacattgaataaggctaatatggactacagtaaaatcgctggtgtagaattc
atgaccccatcattgacatcaccaggggtatcagaaggattacgcgaagaaataactaag
attccaggagcttcaacaattggtcaggtaatagatatgttgccaaatattttctcaagc
gatagcagtgatgatgctggtgaaggtagtacattacatgggcttacagcaggattaaac
agatttaatacctacatcaaacactacgattcatcaattaacggatatgcaatagctgaa
tttacttcttctgaattgatatggaaagtatacgcaattaacaagtcagattgcgatgtc
gcagacgatggaagcaccatttctaaaaaaggagtgaacaagcatcttgctaaaacaatg
aagtacgatccaagcactattaacctagatgattaa

DBGET integrated database retrieval system