KEGG   Rivularia sp. PCC 7116: Riv7116_6557Help
Entry
Riv7116_6557      CDS       T02364                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
riv  Rivularia sp. PCC 7116
Brite
Enzymes [BR:riv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Riv7116_6557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(8286009..8286611)
Genome map
AA seq 200 aa AA seqDB search
MIELYTFTTPNGRKASIMLEEVELPYNVHVIDISKNDQFAPEYVAINPNSKIPAIVDKDT
DTTVFESGAILMYLADKTGKLLPKEQKSRYQVIEWLMLQMGSIGPMFGQFNHFNLHAPEK
IPYAIERYKKETLRLYGVLDKQLADNEFICGDYSIADVATFPWVTIYEIQEMTLDNHPNL
KRWHDTVSKRPAVQRGMKVP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattgagctttatacgtttactacacccaacggacgcaaagcttccataatgttggaa
gaagttgaacttccctacaacgtccatgtaattgatatcagtaaaaacgaccagtttgct
cctgagtatgtagctattaatcccaacagtaaaattccagcaatcgtagataaagatact
gacacaacagtatttgaatcaggtgcaatattaatgtacttagccgataaaacaggaaaa
ttattacccaaggaacaaaaatctcgctatcaggtaatagaatggttaatgctgcaaatg
ggtagtataggtccaatgttcggacagttcaaccactttaatctgcacgctccagaaaaa
attccctacgctatcgaacgctacaaaaaagaaacactgcgactttacggagtattagat
aagcaattagctgataacgaatttatttgtggcgattactccatagccgacgtagcaacg
ttcccttgggtgacaatctacgaaattcaagaaatgacactcgacaaccatcccaactta
aaaagatggcacgacaccgtatcaaaacgcccagcagtacaacgggggatgaaggttcct
taa

DBGET integrated database retrieval system