KEGG   Rivularia sp. PCC 7116: Riv7116_6677Help
Entry
Riv7116_6677      CDS       T02364                                 

Definition
(GenBank) PAS domain S-box
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv02020  Two-component system
riv02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:riv00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Riv7116_6677
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Riv7116_6677
Enzymes [BR:riv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Riv7116_6677
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Riv7116_6677
Two-component system [BR:riv02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Riv7116_6677
Bacterial motility proteins [BR:riv02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Riv7116_6677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheR_N PAS PAS_4 PAS_9 PAS_10 PAS_8 Spc7 WEMBL Mnd1 Fez1 IncA APG17 DUF4795 HMMR_N PAS_7 DUF4686 HOOK UPF0449 DUF3450 Golgin_A5 Exonuc_VII_L ADIP HemX APG6 GAS FPP Tropomyosin Methyltransf_31 CALCOCO1 Seryl_tRNA_N DUF1664 OmpH DUF2959 DASH_Duo1 SesA LMBR1 MCPsignal Med30 HAUS-augmin3 TMPIT HIP1_clath_bdg UPF0154 Mod_r CENP-K COG2 THOC7 FapA zf-C4H2 DUF4407 TPR_MLP1_2 Spc24 ZapB Fmp27_WPPW DUF740 RPW8 FliJ Jnk-SapK_ap_N ATG16 DUF724 Atg14 WXG100 Reo_sigmaC IFT57 DUF3540 Filament Syntaxin-6_N CENP-H Uso1_p115_C HrpB7 AAA_11 Bap31 KxDL Tropomyosin_1 DUF3153 DUF4618 BLOC1S3 TMF_TATA_bd HALZ FUSC MCC-bdg_PDZ DUF4527 Laminin_II bZIP_1
Motif
Other DBs
NCBI-ProteinID: AFY58999
UniProt: K9RNZ5
Position
8416929..8418785
Genome map
AA seq 618 aa AA seqDB search
MKDTPENPELESLLEYIKNNRAFDFSGYKRASLSRRIRKRMQIIDIENYVEYLDYLEVHP
DEFAELFNTILINVTAFFREPAAWEYIASEIIPNIINNKQANKAIRIWSAGCASGEETYT
VAILLAEALGMEEYSQRVKVFATDVDMEALKYARHANYTHKQVANIPSELLDKYFEPINN
HFSVQKELRRGVIFGRHDLVQDAPISRIDLLICRNTLMYFNSETQSKIIDRFHFALNNGG
FLFLGKAEMLFSRNNLFSPLDLKQRIFTKIHNGNFREMVMEMGYSNNQKQVPQMIERQRI
YEAVFEIDPVAQIVLDAKSTIILANAKARNIFNINIKDIGRSLQDLEISYRPVELRSRID
QVHSNRRAISLKDIEWSTPERETKYLDVQIMPLMHNSTDELLGIKIILSDVTRFKHLQQE
LVHANQELETAYEELQSTNEELETTNEELQSTVEELETTNEELQSTNEELETMNEELQSS
NEELQTMNEEMRESSEELNRVNTFLESILTSLRSGVVVLSSELQILIWNRKAEDLWGLRF
EEVFSQHFMSLDIGLPVEQLRQPLRAILNGERNSHELTLNARNRRGKSIECQIILTPLNN
SKSNIQGIILLMEEREQI
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatacaccagaaaaccccgaattagaaagtttattagaatacataaaaaataac
cgtgcctttgattttagcggttacaaacgtgctagtttgagtcgtcgtattcgcaagcgg
atgcaaataattgatatagaaaactatgtcgagtatttagattatttagaggttcatccg
gacgaatttgctgagctattcaatacaattttaattaatgtcaccgctttcttccgagaa
ccagcagcttgggaatatatcgctagtgaaattattccgaatatcattaataacaagcaa
gctaacaaggcaattcgtatatggagtgctggatgcgcttctggagaagaaacctacacc
gttgcgattttgctagcggaagctttgggtatggaagaatactcgcagcgagtcaaagtt
ttcgcgacagatgtagatatggaagctttaaaatatgctcgccatgcaaattatactcat
aaacaagtcgcaaatattccctcagaattattagacaaatattttgagcctataaataat
catttcagcgtgcaaaaagaattgcgtcgcggggtgatttttggccgtcatgatttagtg
caggatgcacctatttctagaattgacttgctgatatgccgcaacaccttaatgtacttt
aatagcgaaacccaaagtaaaattatcgaccgctttcactttgctttaaataatggtggt
ttcttgtttttgggtaaagccgaaatgctgtttagccgcaataatttattttcaccttta
gatttaaaacaacgaatatttaccaaaattcataacggtaactttcgagaaatggtcatg
gaaatgggttactcaaacaaccaaaaacaagttcctcaaatgattgagcgtcagcgcatt
tatgaagcagtctttgaaatagacccagttgctcaaatagttttagatgccaaaagcaca
attattttagccaacgcaaaagcccgtaatatatttaatattaatattaaagatattggt
cgttcgttacaagatttagaaatttcctatcgtcctgtagaattgcgatcgcgaatcgac
caagttcacagcaaccgacgtgctatttctttaaaagacatagaatggtcaactccagag
cgcgaaaccaagtatcttgatgtgcagattatgccattaatgcataacagtaccgatgaa
ctattaggaatcaaaattattcttagtgacgttacccgctttaaacatttgcagcaagaa
ttagtccatgccaaccaagagctagaaacagcttacgaagaactccaatccacgaatgaa
gaattagaaactaccaacgaggaattacaatcaactgttgaagaactagaaacaaccaat
gaagaattgcaatctaccaacgaagaattggaaacaatgaacgaagaactgcaatctagc
aacgaagaattgcagacaatgaacgaagaaatgcgcgaaagtagtgaagaactcaaccga
gttaatacttttctagagtctattttgacaagtttacgttctggggtagtagttctaagt
agcgaattgcagattttgatttggaaccgtaaagcagaagacttatggggattgcggttt
gaggaagtattttcacaacactttatgagtttagatattggtttacctgtagaacaactc
agacaaccgctacgagcaattcttaatggtgaaagaaatagtcatgaactgacattaaat
gccagaaatcgcagaggtaaatcaattgaatgtcaaatcattttaactcctcttaataat
tcaaaatcaaatattcaaggaataattttgttaatggaagaacgcgaacaaatttaa

DBGET integrated database retrieval system