KEGG   Rivularia sp. PCC 7116: Riv7116_6749Help
Entry
Riv7116_6749      CDS       T02364                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
riv  Rivularia sp. PCC 7116
Brite
Enzymes [BR:riv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Riv7116_6749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8502166..8503281)
Genome map
AA seq 371 aa AA seqDB search
MGAVIIGKKELKRQQILALDDPHCECIKYPGDKSLKERAAKKKILFGTAIRHPLLSTDKE
YARSLIEECSILVSEWGFKWHVYPKPLRPTPQSFDFAAADVMYNFARSHGMKVRGHTLVW
YMSLPPWFEKTVNRQNAKDILEKHINTVVGRYRGKMHSWDVVNEAIEPRDGHPNGLRKTP
WLEFIGEDYIDLAFRLAHKADPEAMLVYNDYGLVYDRPQDEAKRHAVIKLLKRLKSQGTP
IHALGLQAHLDGSETRFNHQILKDFLAQVANLGLKIMVTELDVTDKDLPLDIKVRDRIVA
KAYSNYLKVVLEEPAVIAILTWGLNDKHSWLNEFQPRKDGASVRPLPLDAGGKRKFAWNA
MARAFDTAPSR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcagtgattataggtaaaaaagaattaaaacgtcagcagatacttgctttagac
gacccacattgtgaatgcattaaatatcctggggacaaatctttaaaagaacgtgctgct
aagaaaaaaatactttttggtacagctatacggcatccattgctttcaactgataaagaa
tatgctcgaagtctaattgaagaatgctcgatattagtgtcagagtggggatttaaatgg
cacgtttaccccaagccattgcgtccaacaccccaatcctttgattttgctgcggctgat
gtaatgtataattttgcccgcagtcacgggatgaaagttcgggggcatacattggtatgg
tacatgtctttacctccttggtttgagaagacagtcaaccgtcaaaatgctaaagatatc
cttgaaaaacacatcaacacagttgtaggacgttaccgaggaaaaatgcattcttgggat
gtggttaatgaagctatcgaaccaagagatgggcatcctaacggtttaagaaaaacgccg
tggttggagtttataggagaagattatattgaccttgcttttcgtttagctcataaagcc
gatccagaagcaatgctagtttataacgattatggtttagtttacgacagaccccaagac
gaagccaaacgacatgccgttattaaactcttaaagcgtttaaaatctcaaggaactccc
attcacgctttaggtttacaagctcatctagatggcagcgaaactagatttaatcatcag
atattaaaagattttctagcccaagttgccaacctgggtttaaaaatcatggtaacggaa
cttgatgttacagataaagatttaccccttgacatcaaagtgcgggacagaatagttgct
aaagcttacagcaattatttgaaagttgtgttggaagaaccagcagtaatcgcgatttta
acttggggattaaacgataaacatagttggctcaacgaatttcagcctcgaaaagacggc
gcatcggttcgacctttgccattagacgcagggggaaaacgtaaatttgcttggaatgct
atggctcgtgcttttgataccgcaccaagccgttaa

DBGET integrated database retrieval system