KEGG   Roseburia intestinalis XB6B4: RO1_02490Help
Entry
RO1_02490         CDS       T02597                                 

Definition
Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rix00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(219657..220385)
Genome map
AA seq 242 aa AA seqDB search
MELSYKEIRAQICDVCHKMWQLGWVASNDGNVSVKLSDGTFLATPTGVSKSMVTPEMIVH
INKAGEMIETVDGYRPSSEMRMHFRCYEEREDVGAVLHAHPPVATGFAVADIPLDEYSMI
ETVLALGSVPIAPYATPSTDEVPDAITPYLQEHDAILLKNHGAVTVGADVYTAYYRMETL
EQFAKITLTAHLLGGAKEIDRENIDRLVDLRNNYYKMSGKHPGYKKYSGESHFASKNRED
CR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggaactcagttataaagaaatcagagcacagatctgtgatgtgtgccataagatgtgg
cagcttggatgggttgcgtcgaatgacggaaatgtgtcggtaaaactttccgatggcaca
tttttagcaacgccgaccggcgtgtcaaaaagtatggtaacaccggaaatgatcgtgcat
ataaataaagcaggagagatgatcgaaactgtggacgggtaccgcccgtcgtccgaaatg
cggatgcatttcagatgttatgaagaacgcgaagatgtcggggcggtattacatgcacat
cctccggttgcaacgggatttgccgtggcagacattccgctcgatgagtattccatgatc
gagactgtgctcgcacttggttcagtgccgattgcgccttatgcgacaccttccacagat
gaggtgccggatgccattaccccgtatctgcaggaacatgatgcgatcctgttaaaaaat
catggagcggtaacagttggagccgatgtttatacggcgtattaccggatggaaacgtta
gagcagtttgcgaaaataacactgacggcacatctgctcggcggtgcaaaagaaattgac
cgggaaaatatcgaccggcttgtggatcttagaaacaattattataaaatgagtggaaaa
catccgggatataagaaatatagtggtgagtcgcattttgcttcgaaaaacagggaggat
tgcagatga

DBGET integrated database retrieval system