KEGG   Roseburia intestinalis XB6B4: RO1_02500Help
Entry
RO1_02500         CDS       T02597                                 

Definition
Pectin methylesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rix00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RO1_02500
   00500 Starch and sucrose metabolism
    RO1_02500
Enzymes [BR:rix01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     RO1_02500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
220517..221623
Genome map
AA seq 368 aa AA seqDB search
MQKILHVSDNPEHFSSIGSALAQIPANNTTPVIIEIAPGIYHEKLTINKPYITLRGMGES
SAHTVISYDDYALDLMEDGSKRGTFRTYTLFIDTHDVTLQHLTIENASGDSATHGQAIAL
YADGDRLMIDSCRLLGHQDTLFTGPLPEKERQPGGFIGPKQFAPRINGRQYYKNCYICGD
IDFIFGSATAYFEHCTLESLLRTKTSAQSDLVSTTSTLHDSGSDTSALCHSNSDMVQKNY
TLPPIQGYVTAASTPEGQEYGYIFSDCRFISKDCPAGSVYLGRPWRDYAKTILISCELGA
HIHPAGFHDWNRENTHDTVYYAEYASFPATSDYRPLSDRADFVQNLNEQQAGYFAKELVL
GDWAPDKL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatacttcatgtttccgacaacccggaacatttttcctccatcggctctgcc
cttgcacaaattcctgctaataacacaacacctgttatcattgaaattgcaccgggcatt
taccatgaaaaactaaccataaataaaccatatatcacacttcgcggaatgggcgaaagc
agtgctcacaccgtcatcagctatgatgattatgccctggatctgatggaagatggcagt
aagcgcggtacattccgcacttataccctctttatcgatacacatgatgtaacgctccag
catctcaccatcgaaaatgcctccggggattccgcaacacacggacaggcgatcgctctc
tatgccgacggggaccgtcttatgatcgattcctgccgccttctcggccatcaggacaca
ctttttaccgggccgcttcccgaaaaagaacgacagcctggcggtttcatcggtccaaaa
cagtttgccccgcgtatcaatggcagacaatattataaaaactgctatatctgcggcgat
attgattttatttttggaagcgccaccgcatattttgaacactgtaccttagaatccctg
ctgcgcacaaaaacatctgcacagtccgatttagtttccactacatccaccctgcatgat
tccggttctgatacatctgcactgtgtcattccaattcagatatggttcagaaaaattat
acactccctcctatccagggttatgtaactgccgcctccacaccggaaggccaggaatac
ggctacattttttccgactgccggttcatctccaaagactgccctgccggttccgtctat
cttggcaggccatggcgcgactatgcaaaaacgatcctgatttcctgtgaacttggtgcg
catatccatcccgccggttttcatgactggaaccgcgaaaatacacatgacacagtatat
tatgctgaatacgcaagtttccctgccacctctgactaccgtccgctttctgaccgagct
gattttgttcaaaatctgaatgaacaacaagccggatattttgcaaaagaactggttctc
ggtgactgggcacctgataaactgtaa

DBGET integrated database retrieval system