KEGG   Roseburia intestinalis XB6B4: RO1_10650Help
Entry
RO1_10650         CDS       T02597                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rix00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RO1_10650
  Lipid metabolism
   00561 Glycerolipid metabolism
    RO1_10650
   00600 Sphingolipid metabolism
    RO1_10650
Enzymes [BR:rix01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RO1_10650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1073416..1075824
Genome map
AA seq 802 aa AA seqDB search
MITVENQLFSLHTRHTSYLFRVMETGHLEHLYYGRKIHPAIDGLMEQHAFAPGNTNIYDS
EHLQFSLEDTCLEMSSFGKGDIREPFVELTLSDGSETSDFLFEKFEQGTGKEEFETLPGS
YDESGEVEWLGVTLRDKNSGVILELHYYVYEDCDVITRSAKLINESGDVVKLNRLMSLQL
DLEPSDYVFTTFHGAWAREMGRTDVRLVPGKYVNASYTGTSSSRDNPFVMLGKEHTTEDA
GECFGFNLIYSGNHYEAAEVGSFGKVRIVSGINPQSFCFTLESGESFEAPEAVMTYASDG
YNAMSQNMHRFVREHIVRGTWKKKERPVLLNSWEAAYFDINERKLLSLAKAGKEAGIELF
VMDDGWFAKRDNDTRSLGDWQPNPKKLPGGLKGIADKIKAIGMDFGIWVEPEMVNVDSDL
YRSHPDWVIEIPGKAHSEGRNQRILDLTRKDVQDHIIEEMGRVFSSADISYVKWDMNRTF
SDYFSQSIRPERQGEVAHRYVMGLYRCMRELTKRFPDILFEGCAAGGNRFDLGMLCYFPQ
IWASDDTDALCRAEIQTGYSYGYPMSVISAHVSGCPNHQTLRTTPLETRFAVAAFGLLGY
ECNFCDLKKEESEAIKAQIILYKKWRSVLQQGIFYRGRSFTGNGRGNAFGKNSVLWNDDS
NVTEWTCVSPDQSKAVGFVMQKLVVPNTQFGYYKPQGLCEEKKYHFYNRSLKYNVKEFGD
LVNTVSPIHIRQDSIAHNLVAKFVKMDGEKENITAYGDTLMYGGVKLKPAFSGNGYNENV
RYFQDFGARMYFMEEAFEDHAL
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagtcgaaaaccagttattttccctgcataccagacatacttcttatctgttc
cgtgtcatggaaaccggacatttggagcacttatattatggaagaaaaattcatccagcc
atagacggattgatggaacagcatgcatttgcgccgggcaataccaatatttatgacagt
gaacatctgcagttttccttagaggacacatgtcttgagatgtcctctttcgggaaaggc
gatatcagggagccttttgtggaactgacactttccgatggaagcgaaacgtctgatttc
ctgtttgaaaaatttgaacagggaaccggaaaggaagaatttgagacacttccgggatcg
tatgatgagtccggtgaggtggagtggcttggtgtgacactgcgcgataaaaacagcgga
gtcatattagaactccattattatgtctatgaggactgtgatgtgatcacaaggagcgca
aaactcatcaatgagagcggggatgtggtaaagttaaaccgcctgatgagcctgcagctt
gatttagaaccgtccgactatgtgtttacaacatttcacggggcttgggcacgtgaaatg
gggcgcacggacgtacggctggtgccgggaaaatatgtaaacgcctcttacacgggaacg
tcgtcgagccgtgacaatccgtttgtgatgcttggaaaagaacataccacggaggatgcg
ggggaatgttttggatttaatctgatctacagcggcaatcactatgaggcggcggaggtc
ggcagttttggaaaagtaagaatcgtatccgggatcaatccgcagtcgttctgttttaca
cttgagtcaggggagagttttgaggcgccggaggcggtaatgacctacgcatcagacgga
tataatgccatgagccagaatatgcaccgttttgtgcgggagcacattgtgaggggaacc
tggaagaaaaaggagcgcccggtgctcttaaacagctgggaggcagcctattttgacatt
aatgaaagaaaactgctctcacttgcaaaagcgggaaaagaggcgggcattgagcttttc
gtcatggatgacggctggtttgcaaaacgtgataatgatacgagatcgttaggagactgg
cagccaaatccaaagaaactgccgggcggtttaaaggggattgcagataagatcaaggcg
attggcatggattttggaatctgggtggagcctgagatggtcaatgtggacagtgatctc
taccgcagccatccggactgggtgatcgagattccgggaaaggcgcactcggaagggcgc
aatcagaggatccttgatctgaccagaaaggacgtgcaggatcatatcattgaggagatg
ggcagagtattttcctccgcggacatttcctatgtaaaatgggatatgaaccgcacattt
tcggattatttttcacagagtatccgtcctgaaaggcagggggaggtggcacaccggtat
gtgatgggactttaccgctgcatgagggagctgacaaagagattcccggacatcctgttt
gagggctgtgctgcgggtggaaaccgttttgaccttggtatgctctgttatttcccacag
atctgggcgagcgatgatacagatgcgctctgccgtgccgagatccagaccgggtacagc
tacggctacccgatgtccgtgataagcgcacatgtctccggctgcccaaatcatcagaca
ctgcgcacgacaccgcttgaaacacgttttgcggtagcggcgtttggactgctcggatat
gagtgcaatttctgtgatctgaaaaaagaagagtcagaagccatcaaagcgcagatcatt
ctttacaaaaaatggcgcagtgtgctgcaacagggaattttttaccgtggcaggagtttt
acagggaacggcagaggaaatgcgtttggaaaaaacagtgtcctctggaatgatgacagc
aatgtgacggaatggacgtgcgtctcgccggatcagtcgaaggcggtcggcttcgtcatg
cagaagcttgtcgtgccaaacacgcagttcgggtactataaaccacagggactctgtgag
gaaaagaagtatcatttttataaccgttctttaaaatataatgtcaaagagttcggggat
ctggttaacaccgtatcaccgatccatatcagacaggactccattgcgcacaatctggtt
gcaaagtttgtgaaaatggacggggaaaaggagaatattacggcatacggggataccctg
atgtatggcggcgtgaagttgaaaccggcattttccggcaatggatataatgagaatgtg
agatattttcaggatttcggggcgcggatgtattttatggaagaggctttcgaagatcat
gctctatga

DBGET integrated database retrieval system