KEGG   Roseburia intestinalis XB6B4: RO1_10650Help
Entry
RO1_10650         CDS       T02597                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rix00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rix00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:rix00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1073416..1075824
Genome map
AA seq 802 aa AA seqDB search
MITVENQLFSLHTRHTSYLFRVMETGHLEHLYYGRKIHPAIDGLMEQHAFAPGNTNIYDS
EHLQFSLEDTCLEMSSFGKGDIREPFVELTLSDGSETSDFLFEKFEQGTGKEEFETLPGS
YDESGEVEWLGVTLRDKNSGVILELHYYVYEDCDVITRSAKLINESGDVVKLNRLMSLQL
DLEPSDYVFTTFHGAWAREMGRTDVRLVPGKYVNASYTGTSSSRDNPFVMLGKEHTTEDA
GECFGFNLIYSGNHYEAAEVGSFGKVRIVSGINPQSFCFTLESGESFEAPEAVMTYASDG
YNAMSQNMHRFVREHIVRGTWKKKERPVLLNSWEAAYFDINERKLLSLAKAGKEAGIELF
VMDDGWFAKRDNDTRSLGDWQPNPKKLPGGLKGIADKIKAIGMDFGIWVEPEMVNVDSDL
YRSHPDWVIEIPGKAHSEGRNQRILDLTRKDVQDHIIEEMGRVFSSADISYVKWDMNRTF
SDYFSQSIRPERQGEVAHRYVMGLYRCMRELTKRFPDILFEGCAAGGNRFDLGMLCYFPQ
IWASDDTDALCRAEIQTGYSYGYPMSVISAHVSGCPNHQTLRTTPLETRFAVAAFGLLGY
ECNFCDLKKEESEAIKAQIILYKKWRSVLQQGIFYRGRSFTGNGRGNAFGKNSVLWNDDS
NVTEWTCVSPDQSKAVGFVMQKLVVPNTQFGYYKPQGLCEEKKYHFYNRSLKYNVKEFGD
LVNTVSPIHIRQDSIAHNLVAKFVKMDGEKENITAYGDTLMYGGVKLKPAFSGNGYNENV
RYFQDFGARMYFMEEAFEDHAL
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagtcgaaaaccagttattttccctgcataccagacatacttcttatctgttc
cgtgtcatggaaaccggacatttggagcacttatattatggaagaaaaattcatccagcc
atagacggattgatggaacagcatgcatttgcgccgggcaataccaatatttatgacagt
gaacatctgcagttttccttagaggacacatgtcttgagatgtcctctttcgggaaaggc
gatatcagggagccttttgtggaactgacactttccgatggaagcgaaacgtctgatttc
ctgtttgaaaaatttgaacagggaaccggaaaggaagaatttgagacacttccgggatcg
tatgatgagtccggtgaggtggagtggcttggtgtgacactgcgcgataaaaacagcgga
gtcatattagaactccattattatgtctatgaggactgtgatgtgatcacaaggagcgca
aaactcatcaatgagagcggggatgtggtaaagttaaaccgcctgatgagcctgcagctt
gatttagaaccgtccgactatgtgtttacaacatttcacggggcttgggcacgtgaaatg
gggcgcacggacgtacggctggtgccgggaaaatatgtaaacgcctcttacacgggaacg
tcgtcgagccgtgacaatccgtttgtgatgcttggaaaagaacataccacggaggatgcg
ggggaatgttttggatttaatctgatctacagcggcaatcactatgaggcggcggaggtc
ggcagttttggaaaagtaagaatcgtatccgggatcaatccgcagtcgttctgttttaca
cttgagtcaggggagagttttgaggcgccggaggcggtaatgacctacgcatcagacgga
tataatgccatgagccagaatatgcaccgttttgtgcgggagcacattgtgaggggaacc
tggaagaaaaaggagcgcccggtgctcttaaacagctgggaggcagcctattttgacatt
aatgaaagaaaactgctctcacttgcaaaagcgggaaaagaggcgggcattgagcttttc
gtcatggatgacggctggtttgcaaaacgtgataatgatacgagatcgttaggagactgg
cagccaaatccaaagaaactgccgggcggtttaaaggggattgcagataagatcaaggcg
attggcatggattttggaatctgggtggagcctgagatggtcaatgtggacagtgatctc
taccgcagccatccggactgggtgatcgagattccgggaaaggcgcactcggaagggcgc
aatcagaggatccttgatctgaccagaaaggacgtgcaggatcatatcattgaggagatg
ggcagagtattttcctccgcggacatttcctatgtaaaatgggatatgaaccgcacattt
tcggattatttttcacagagtatccgtcctgaaaggcagggggaggtggcacaccggtat
gtgatgggactttaccgctgcatgagggagctgacaaagagattcccggacatcctgttt
gagggctgtgctgcgggtggaaaccgttttgaccttggtatgctctgttatttcccacag
atctgggcgagcgatgatacagatgcgctctgccgtgccgagatccagaccgggtacagc
tacggctacccgatgtccgtgataagcgcacatgtctccggctgcccaaatcatcagaca
ctgcgcacgacaccgcttgaaacacgttttgcggtagcggcgtttggactgctcggatat
gagtgcaatttctgtgatctgaaaaaagaagagtcagaagccatcaaagcgcagatcatt
ctttacaaaaaatggcgcagtgtgctgcaacagggaattttttaccgtggcaggagtttt
acagggaacggcagaggaaatgcgtttggaaaaaacagtgtcctctggaatgatgacagc
aatgtgacggaatggacgtgcgtctcgccggatcagtcgaaggcggtcggcttcgtcatg
cagaagcttgtcgtgccaaacacgcagttcgggtactataaaccacagggactctgtgag
gaaaagaagtatcatttttataaccgttctttaaaatataatgtcaaagagttcggggat
ctggttaacaccgtatcaccgatccatatcagacaggactccattgcgcacaatctggtt
gcaaagtttgtgaaaatggacggggaaaaggagaatattacggcatacggggataccctg
atgtatggcggcgtgaagttgaaaccggcattttccggcaatggatataatgagaatgtg
agatattttcaggatttcggggcgcggatgtattttatggaagaggctttcgaagatcat
gctctatga

DBGET integrated database retrieval system