KEGG   Roseburia intestinalis XB6B4: RO1_10860Help
Entry
RO1_10860         CDS       T02597                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rix00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1093332..1094873
Genome map
AA seq 513 aa AA seqDB search
MRTSGVLMHISSLPSPYGIGTMGKEARKFADFLKKAGQKYWQILPICPTSYGDSPYQSFS
SFAGNPYFIDLEYLCKEKLLTKKECESFSWGTNPQYVDYGQMYISRYPLLKKAYDRFRKN
EPEDFAAFCKDEAEWLDEYALFMALKDANGGVAWFEWEKDLKTRKTEALKEARVTYAEDI
AFYKMLQYLFFKQWWDLKAYVNDLGIEIIGDVPIYVAGDSADVWADPGQFYLDKELNPID
VAGCPPDAFSADGQLWGNPLFRWDAMKKDGYSWWTKRVKAMSKLYDIVRIDHFRGFDSYY
AIPAKDDTARNGEWRKGPGMDLFRTMEKKLGKLNIIVEDLGFLTPSVLKLVKDSGFPGMK
VIQFAFDSREGSDYLPHNYEKHCVVYTGTHDNDTLMGWMKTAPKASVKFAKEYLNLTEEE
GFNWGMMRAAWASVGDMAIVPMQDLIGIGSEGRMNTPSTLGGNWEWRATSDQITGKLAKR
LYKYMEMYGRLNKDQEEEEETEAEEKKVSAEEK
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccagcggtgtgctgatgcacatatcttccctgccgtctccttacggaatcggt
actatgggaaaagaagcaagaaaatttgcagattttttgaaaaaggcaggtcagaaatac
tggcagatcctgccaatctgtccgaccagctacggagattccccgtatcagtctttttcc
agctttgcaggtaatccttattttattgatttagaatatctttgcaaagaaaaattactg
acaaaaaaagaatgtgaatcattttcgtggggaaccaatccgcagtatgtggattatggt
cagatgtatatctcacgttatcctttgttaaagaaagcatatgacaggttcaggaaaaat
gagccggaagattttgcagcattctgcaaggatgaagcagagtggttggatgaatatgca
ctttttatggcattaaaagatgctaacggcggtgttgcatggtttgagtgggaaaaagac
ttaaaaaccagaaaaacggaagccttaaaagaagcgcgggttacctatgcagaagatatt
gcgttttataaaatgttacagtatctgttctttaaacagtggtgggatttaaaagcgtat
gtcaatgatcttggcattgagatcatcggtgacgtgccgatctatgttgccggagacagt
gcagatgtatgggcagatccgggacagttctatcttgataaagaattaaatccgattgat
gtagcaggctgcccgccggatgcattctcggcagacggacagctctggggcaatccgtta
ttccgctgggatgctatgaaaaaagacggttacagctggtggacgaagcgtgtaaaagcg
atgtcaaaattatacgatatcgtccgtatcgatcatttccgcggtttcgattcttactat
gcgatcccggcaaaagatgatacggcgagaaatggtgagtggagaaaaggtcctggcatg
gatctgttccgtacgatggagaaaaaactcggaaagttaaatatcatcgtggaggatctt
ggtttccttacaccttccgttttaaaactggtaaaagattccggattcccgggaatgaaa
gtcatccagttcgcatttgattcaagagagggcagcgactatctgccgcacaattatgag
aaacactgtgttgtttataccggaacacatgacaatgatacgttgatgggctggatgaag
acagcaccgaaggcaagtgtcaaatttgcaaaagagtacttaaatctcacggaggaagaa
ggttttaactggggtatgatgcgcgctgcatgggcatcagtcggagatatggcgatcgtt
ccgatgcaggatctgatcggaatcggttccgagggacgtatgaatacaccgtccacactc
ggcggtaactgggagtggagagcaacttcagaccagatcaccggaaaacttgcaaaacgt
ctctataaatatatggagatgtatggacgtttaaacaaagatcaggaagaggaagaagaa
accgaagcggaggagaagaaagtatccgcagaggaaaaataa

DBGET integrated database retrieval system