KEGG   Roseburia intestinalis XB6B4: RO1_13290Help
Entry
RO1_13290         CDS       T02597                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rix00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RO1_13290
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RO1_13290
Enzymes [BR:rix01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     RO1_13290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1340535..1341386
Genome map
AA seq 283 aa AA seqDB search
MDQKSFHFHEKKRVVVKIGSSSLNYEETGNLNFTKLEHLVRELCNLRNRGMDVCLVSSGA
IAVGRQSLGMTERPRELSTKQACAAVGQARLMMIYQKLFAEYNQVAGQVLMTKNTMVNPV
SRENAKNTFDELFRLGAIPIVNENDTVSTYEMQFGDNDTLSAIVASLIGADLLILLSDID
GLFTDDPHKNPDAKLIEVVEKMDSDILGMAKSTTGSDVGTGGMATKLTAAKIATLSGTDM
IIANGADVCVLHHIFDDSFRGTIFKAQKKETFRIQDFILETIG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggaccagaaaagttttcactttcatgagaaaaaaagagttgtagttaaaatcggttct
tcttcgttaaattatgaggagaccggcaatttgaattttacaaaactagagcacctggtg
cgcgagctttgcaatttaagaaaccgggggatggatgtgtgtttagtcagttccggtgcg
atcgccgtcggcagacagtcgcttggcatgacagagcggccgcgggaactctctacaaaa
caggcatgtgcagcagtcggacaggcaagactgatgatgatctaccagaaactgtttgca
gagtataatcaggtggcaggtcaggtacttatgacaaaaaataccatggtcaatccggtt
tccagggaaaatgcaaagaatacatttgatgaattgttccgtttaggtgcgatcccgatc
gtcaatgaaaatgacacagtatctacttatgagatgcagtttggtgacaatgatacactt
tctgcgatcgttgcgtccctgatcggtgcagatcttttgattttattatcagatattgac
ggattgtttacagacgatccgcataaaaatccggatgcaaaactgatcgaagtggtcgaa
aagatggattcagacattcttggaatggcaaagagcacgaccggaagtgatgtcggaacc
ggaggcatggcaaccaaactgacagcagcaaagatcgcaacactttccgggacagatatg
atcattgcaaacggagcagatgtctgtgtgctgcatcatatttttgatgacagctttagg
ggaaccatttttaaggcacagaaaaaggaaacattccgtatacaggattttatattagaa
acaatcggatag

DBGET integrated database retrieval system