KEGG   Roseburia intestinalis XB6B4: RO1_14100Help
Entry
RO1_14100         CDS       T02597                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rix01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:rix00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1421866..1423158
Genome map
AA seq 430 aa AA seqDB search
MRIIELTEEARTNILENLLKRSPNSYGEFEGRVNEIIENVRANRDAAIFDYTKRFDGADI
NAENILVTEDEIKEAYEKVDEKLLTVIRKALVNIRKYHEKQRQYSWFDSEESGIILGQKV
TALEKVGVYVPGGKAVYPSSVLMNIVPAKVAGVKTIVMTTPPGKDGKVNPATLVAAKEAG
VDAIYKVGGAQAIAALAFGTESVPKVDKIVGPGNIYVALAKKAVFGFVSIDSIAGPSEIM
VLADETANPRFVAADLLSQAEHDEMASAILVTTSRDLAEQVSKEVEGFVAQLSRKEIIQK
SLDNYGYILVAESMDEAIATVNEIASEHLELVTKNPFETMTKIRNAGAIFVGEYSSEPLG
DYFAGPNHVLPTNGTAKFFSPLSVDDFIKKSSIISYSREALEPIYKDIVQFAECEQLTAH
ANSIRVRFED
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattatagaactgacagaagaggcaagaacaaatatactggaaaatcttttaaaa
agaagcccgaattcctatggtgaatttgaaggcagagtaaatgagatcatagaaaatgta
agggcaaaccgcgatgcagcgatctttgattacacaaagcgttttgatggagctgacatc
aacgcggagaatatccttgtgacggaggatgagattaaagaggcctacgaaaaagtggat
gaaaaactgcttacggtgatccgcaaggcgctggtaaatatccgcaaatatcatgaaaaa
cagcgccagtattcttggtttgattccgaggagtccggcattattttaggacagaaagtg
actgccttggaaaaagtcggcgtttatgtaccgggcggaaaggcagtttatccgtcctcc
gtgcttatgaacatcgttccggcaaaggttgcgggtgtaaaaactatcgttatgacaaca
cctcccggaaaagacggaaaagtcaatccggcgaccttagttgcggcaaaagaggcaggt
gtggatgcgatctataaagtcggcggtgcacaggcgatcgcagcgctggcatttggtacg
gaaagcgttccaaaggtagacaaaatcgtaggtcctggtaatatctatgttgccctggca
aagaaagccgtatttggttttgtaagcattgactccattgcaggccctagtgagatcatg
gtgttagcagatgaaactgcaaacccgcgttttgttgcagcagaccttctctcgcaggca
gaacatgacgagatggcatctgcgatccttgttacaacgagcagggatttagcggagcag
gtatcaaaagaagtggaaggttttgtggcacagttatccagaaaagaaatcattcagaag
tctttggataattatggttatatcttagtggcagaaagtatggacgaggcgatcgcgaca
gtgaacgagattgcatccgagcatcttgaacttgtcacaaagaatccatttgagacgatg
acaaagatccgcaacgcgggagcaatttttgtcggggaatattccagtgaaccattgggt
gattatttcgccggtccaaaccatgtgctgccgacgaacgggactgcaaaatttttctca
ccgcttagcgtggatgattttatcaaaaagtcaagcattatctcttattcaagagaggca
ttagagccgatttataaagatatcgtacagtttgcagaatgtgaacagttaacggcgcat
gcaaattcaatccgtgtacgatttgaagactag

DBGET integrated database retrieval system