KEGG   Roseburia intestinalis XB6B4: RO1_31190Help
Entry
RO1_31190         CDS       T02597                                 

Definition
Listeria/Bacterioides repeat
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
rix  Roseburia intestinalis XB6B4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3121106..3125176
Genome map
AA seq 1356 aa AA seqDB search
MVFTGIGPVLTPYLENAVVYADENENSGVKKVFTADQLKVAWGDADYELADGQWKLSFAK
QYNQVKWTLPESIEMSQVNAVTFQVADQKVPISLKVYNGGDDATAANTQYGLSGQTEYTI
NPSGDGAIDAVGIMITEDKPENATVSLVSVTFELKAGAGDAKLGDNIIKNGDFAASEAAE
SWNSAAGESVVSVAAEEEEIADSGLKTYGVLTRNQETATPGDCFSQDITDAVEKGETYKF
SFWAKLSDDYKDAPEEQRNVEFAPFYVSGGEATYLGSYSAGILSGDCTKTLKAGEWTKYE
GTFKIPKAADQVVIRIIEQGTNYGQGDCVKGTYYVTGVSMNKIEREKPSIEKDIPDWKES
VKAALGNDVVAGTAVTGDEINDDTLMELVEKHFNAVTLGNELKPDALFNYQLEDKVNTKT
IQFKGQDLEVPVVNEAGDSLDFSRADKLINKICEWNNENPDNKIRIRGHVLVWHSQTQEW
FFHENYDKTKPYVDKETMNRRLEWFISSVFDHYFGEAANGKYDGLFYGWDVVNEAVIGNS
YRTDTVSAAESLDEIRHGNNSSWWHVYKSNEFIINAFRYANQYAPKNVELYYNDFGETDN
TKCEGIVKLINDVKAADGTRLDAFGMQAHYSVDSFSATQFKTVAEKYAKAAGKVQLTELD
FKSSASYTSGMATKESEYTKIAYCHKQLFDAIKGLKADGSNVSGLTVWGVIEPNSWLHEQ
SGVGGGADGSAQCPLLFDGNYKAKPAYWAYVDASRLQPSIQDVVAAEKKGDAVTGKTYSI
MQNDITASFISMWDKDGLTVQVTVEDAVKDDNDAVAVYVDSANSGKDDITPVTVTVKRSE
AAEVENGYQATIKVPLSGLSVAKVIGMDVVVTNGDKTAAFNDLTGKQGTSSKYYAKVTMK
PGVEKAAYGTVTVDGDKDAVWDNAGTIPITINLGSNISANAKLLWDKDNFYVYAEIKDPV
LNNTNGDAWEQDSLEVFIDENNGKSNSYEDDDKQYRISYVNDHSFNGKKCLEENMKSVAK
ITSDGYVVEASFKWTDITPKAGDEIGLEFQINDADASGKRIGTLSWNDETGMGWSKPEVF
GTVKLGEIKNAPEKDTEKKPETEKKEVKVKKITLNKTKAGMKKGATLTLKAVVSPSDADI
KDVKWTSSNKKVATVDKHGKVKALKNGVTTITATAKDGSRVSASCKITVGYKITYKLGKG
KNSSKNPEYYYNEKVNLKSASKKGYVFKGWYTDSKYTKRIKTISKSSKKNLTLYAKWQKV
TVKKSAIKKMKAVSGRKAKVTVQKVEGAAGYQIVYSTDKQFKKNVKKVTISGTSKTLGKL
AKGKTYYVKVRAYKKDSTGAKVYGSFSSAKKIKISK
NT seq 4071 nt NT seq  +upstreamnt  +downstreamnt
atggtttttaccgggataggaccggtgctgacaccatatcttgaaaatgcagttgtctat
gcagatgaaaacgaaaattcaggggtaaaaaaagtttttactgcagatcagctgaaagtg
gcatggggagacgcggattatgaactcgcagatggacagtggaaattgtcttttgcaaaa
cagtataatcaggtgaaatggacgttgccggagagtatcgaaatgtcacaggtgaatgct
gttacatttcaggtggcggatcagaaagtaccgatcagtctgaaagtatacaacggtgga
gatgatgcaacagcagctaatacacagtacggattaagcggacagacggagtatacgata
aatccatcgggggatggcgctattgatgcagtcggaatcatgataacggaagataaaccg
gaaaatgcaacggtaagtcttgtgagcgtgacctttgaactgaaagcaggagcaggcgat
gcaaaattgggggataatattataaaaaacggtgattttgcagcgtccgaagcggcggag
tcatggaacagtgcagccggagaatcggttgtttcagttgcagcagaggaagaagagatc
gcagattccggtcttaaaacatacggtgtacttacacgtaatcaggaaactgccacccct
ggggattgtttttcgcaggatatcacggatgcggttgaaaaaggggaaacatacaaattc
tcattctgggcgaaattgtccgatgattacaaagatgctccggaagagcagagaaatgtg
gagtttgcaccattctatgtttccggtggtgaggcaacatatcttggaagttattcagca
ggtattttgtcaggagactgtacaaagacattaaaagctggagaatggacaaaatatgag
ggaactttcaaaataccgaaagctgcagatcaggtggtcatccgtattatagaacaggga
accaactatggacagggcgattgcgtaaaagggacttactatgtgaccggtgtgtccatg
aataagattgaaagagaaaagccatctattgagaaggacatcccggactggaaagaaagt
gtgaaagctgctttaggcaatgatgtagttgccggcacagcagtgaccggtgatgagatc
aatgatgatacgctgatggaactggtggaaaaacactttaatgcggttacacttggaaac
gaattaaaaccggatgcattgttcaactatcagttagaggataaagtcaacacaaagacg
atccaatttaaaggacaggatcttgaagtcccggtcgtaaatgaagccggtgacagcttg
gacttttcacgtgcagataaattaataaataaaatctgtgagtggaataatgaaaatccg
gataacaaaatccgtatccgtggtcatgtccttgtatggcattcccagacacaggaatgg
tttttccatgaaaattatgataaaaccaaaccttatgtggacaaagagaccatgaaccgc
cgtcttgaatggtttatttcaagtgtctttgaccattacttcggggaagctgcaaatgga
aaatatgacggattattttatggctgggatgttgtaaatgaggctgtcattggaaactct
taccgtacagataccgtgagtgcagcggaaagtctcgatgagatccgtcatggaaataat
tcaagctggtggcatgtatataagagcaacgaatttatcatcaatgccttcagatatgca
aaccagtatgcaccgaaaaatgtagagctttattacaacgattttggtgagacggataat
acaaaatgtgagggtattgtaaaactcatcaatgatgtaaaggctgccgatggaaccaga
ctggatgcatttggcatgcaggcacattacagtgtggatagtttttctgccacgcagttt
aaaacagtggctgaaaaatatgcaaaagctgcaggaaaagtacagcttacagagcttgat
tttaaatcaagtgcatcttatacatcaggtatggcaacaaaagagagcgagtatactaaa
attgcatattgtcataaacagttattcgatgcgatcaaaggcttaaaagcagatggttcg
aacgtttccggattgaccgtatggggggtcatcgagccaaattcatggttacatgaacag
tctggtgttggtggtggtgcagacggctctgcgcagtgcccattgctttttgatggaaat
tataaagcaaaacctgcgtactgggcgtatgtagatgcatccagactccagccgtcaatt
caggatgtagttgctgcagagaaaaaaggtgatgcagtgacaggaaagacatacagtatc
atgcagaatgatatcacggcttcctttatttcgatgtgggataaagatggtcttaccgtg
caggttacggtagaagatgccgtaaaagatgataatgatgcagttgctgtttatgtggat
tctgcaaattccggaaaagatgacatcacaccagtgaccgtaacggtaaaaagaagcgag
gcagcagaagtagaaaatggttatcaggcaaccataaaggtaccgttatcaggactttcc
gttgcaaaagtgatcggaatggatgttgtggtcacaaatggggataaaacagccgcattt
aatgatttgacaggaaaacagggaacaagcagtaaatattacgcgaaagtaacgatgaaa
ccaggggtggagaaagctgcctatggtacagttaccgtagacggagataaagatgcggta
tgggataatgccggaaccattccgattacaatcaatctcggctccaatatttctgcaaat
gcgaagttactctgggataaagacaatttttatgtatatgccgagatcaaagatcctgtc
ctcaataataccaacggtgatgcatgggagcaggattccttagaagtatttatcgacgaa
aataatggaaaatccaactcttatgaagacgatgacaagcagtacaggatcagttatgta
aatgatcactcatttaatggaaaaaagtgccttgaagagaatatgaagtctgtggcaaaa
ataacttctgacggatatgttgttgaagcgtcatttaaatggacggatatcacaccaaaa
gccggagatgagatcggacttgaatttcagatcaatgatgctgatgcaagtggcaaaaga
attggtacattgagctggaacgatgaaacaggaatgggatggtctaaaccggaagtattt
ggtactgtaaaacttggagaaattaaaaatgctccggagaaagatacagaaaagaaaccg
gaaacagagaagaaagaagtaaaagttaaaaaaatcacgttaaataaaacaaaagccgga
atgaaaaaaggtgcaacgcttacattaaaggctgttgtttcaccatctgatgcagatatt
aaagacgttaagtggacatcttccaacaaaaaagttgcgactgttgataagcatggaaaa
gtaaaagcattgaaaaatggtgtgaccacgatcacggcaacggcaaaagatggaagcaga
gtaagcgcgtcctgtaagatcacggtaggttataaaattacctataagttaggaaaaggt
aaaaacagcagcaaaaacccggaatattattacaatgaaaaggtaaatttaaaatctgct
tccaaaaagggatatgtctttaagggctggtatacagacagcaagtatacaaagagaatt
aaaacaatctcaaagagcagcaaaaagaatcttactttatatgcgaaatggcagaaagtg
accgtaaagaaatctgcaattaagaaaatgaaagctgtttcgggaagaaaagcaaaagtt
acagtccagaaagtggaaggtgcagccggatatcagatcgtttattctacggataagcaa
ttcaaaaagaatgtaaagaaagtaacaatatcaggcacatcaaaaacacttggaaaattg
gcaaaaggcaagacatattatgtaaaagtacgtgcttataagaaagattccacaggagca
aaagtttatggaagtttcagcagtgcaaagaagataaagatcagtaagtag

DBGET integrated database retrieval system