KEGG   Roseburia intestinalis XB6B4: RO1_31240Help
Entry
RO1_31240         CDS       T02597                                 

Definition
Glycosidases (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:rix00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RO1_31240
Enzymes [BR:rix01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     RO1_31240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3128943..3130430
Genome map
AA seq 495 aa AA seqDB search
MVVSIKTGFYAEMEIDMKKLENKCMLITYSDSMGRNLADLNEILDKYFKKAVGGIHILPF
FPSSGDRGFAPMDYHKVDPAFGDWNDVEHLAEKYYLMFDYMINHISAQSPYYKDFLEKKD
ASEYHDLFIRYKDFWENGEPTEEQVDAIYKRKPRAPYVEAHFADGTSEKVWCTFDEEQID
INCKSETAKRFIRDNLTTLCEHGAAMIRLDAFAYATKKAGTSCFFIEPDVWEFLKECEDI
VKPYGVTLLPEIHEHYTMQEKIAKKDYYVYDFALPMLLINALYYGQTQYLKHWFEICPRK
QFTTLDTHDGIGVVDVKDLLPDEEIGRTKEDIFKFGANVKKIYNTAAYNNLDIYQVNCSY
YSALGDEDDAYLLARAVQFFAPGIPQVYYVGLLAGKNDLKLLEETKVGRNINRHYYTKEE
IDAEVKRPVVAELLRMMEFRNAHPAFDGTFELENSDDDKLVIVRRNGDAWAKLSADFKAK
KFEITYTEDGEVRAF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgagcataaaaacaggattttatgcagaaatggagattgatatgaaaaagttg
gaaaacaaatgtatgctgattacttattcggattcgatgggacgtaatctggcagattta
aacgagattttagataaatattttaaaaaagcagtgggcgggatccatatccttccgttc
ttcccttcttcgggagacaggggatttgcaccgatggattaccacaaagtcgatccggca
tttggtgactggaacgacgtggaacatctggcagaaaagtattacctgatgtttgattat
atgatcaatcatatttcggcacagagcccgtattacaaagactttctggagaaaaaagat
gcatctgagtatcatgacctgttcatccgctacaaagatttctgggaaaacggggagccg
accgaggagcaggtggatgcaatctacaaaagaaagccgcgtgcaccgtatgtggaggca
cattttgcagacggaacatctgaaaaagtatggtgcacgtttgatgaagagcagatcgat
attaactgtaaatctgagacagcaaagcgttttatccgcgacaacttaacaacattgtgt
gagcatggtgctgcaatgatccgtctcgacgcatttgcctatgcaacaaaaaaagccgga
acaagctgctttttcattgagccggatgtatgggagttcttaaaagagtgtgaggatatc
gtaaaaccttacggagtcacacttttaccggaaattcatgagcattacacgatgcaggag
aagatcgcaaaaaaagattactatgtatacgattttgcacttccaatgctgctcatcaat
gcattatactatggacagacacagtatttaaaacactggtttgagatctgcccgcgcaaa
cagttcacaacacttgatacgcatgacggaatcggtgtggtagatgtcaaagatttgctg
ccggatgaggaaatcgggcgcaccaaggaggatatctttaagtttggtgcaaatgtcaag
aaaatctataataccgcagcgtacaataaccttgacatttatcaggtcaactgttcttat
tattccgcacttggtgatgaggatgatgcgtatctgttagcgagagcggttcagtttttt
gcaccgggtattccgcaggtttactatgtcggactgctggcaggaaagaatgacttaaaa
cttttggaagagacgaaagtgggacggaacatcaaccgtcattattatacaaaagaagag
atcgatgcggaagtaaaacgtccggtcgtggcagaacttctgcgcatgatggaattccgt
aatgctcacccggcattcgatggaacgtttgaactcgaaaacagtgacgatgataagctt
gtgatcgtgcgaagaaacggtgatgcgtgggcaaaactttccgctgactttaaggcgaag
aagtttgagatcacttatacagaagacggagaagttcgtgcgttttga

  All links  
No link information was found.   
DBGET integrated database retrieval system