KEGG   Roseburia intestinalis XB6B4: RO1_31280Help
Entry
RO1_31280         CDS       T02597                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rix00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RO1_31280
  Lipid metabolism
   00561 Glycerolipid metabolism
    RO1_31280
   00600 Sphingolipid metabolism
    RO1_31280
Enzymes [BR:rix01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RO1_31280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3134996..3137266
Genome map
AA seq 756 aa AA seqDB search
MERGRIMAIRIDQDQKLITLHTKNTTYQMAVGAYGQLLHLYYGPRLGGDMRYLLTYYDRG
FSGNPYEADCDKTYSMDALPQEYPCFGNGDFRSPAFILKNADGSYCADLRFVSCEICEGK
YRIPGLPAAYDETGTESETLKVYLEDKPSGVQVTLLYGIFAELDIITRAVQITNRGQEAV
HIEKAASAVLDFMTGEFDVIHFHGRHGMERILERTPVEHGNQVFGSRRGSSSHQQNPFVM
LAGKQTGEDAGECYGCMLLYSGNFKAEAEKDQYEQTRLVMGLSDEMFSWKLEPGETFDTP
ETAFSYSANGFSTLSWNLHRLIRSHICRSAYRDTKRPVLINNWEATYFDFTGEKIIEIAK
QAAELGVEMLVLDDGWFGKRDDDLAGLGDWTVNEKKLGMPLGKVAEKIRGLGMKFGIWIE
PEMVCEDSDLYREHPDWAFTIPGRKPVRARYQLVLDYSRKEVVDGIFAQIAKVLDDTKAD
YVKMDMNRHLTDIWSKTAAEQNQGAILHRYVLGVYDFLERLHERYPDLLIEGCSGGGGRF
DAGMLYYTPQIWCSDNTDAVERIKIQYGTSFAYPSCTVGSHVSAVPNHQTGRMTELATRA
AVAMAGSFGYELDLNLLTEEEKEQVREQIKNYHRFEMLIRQGRYYRLTDVWQKKEYAAWE
YCRPDGSEALVTVVTLDTQCNPATEYVKLRGLGEDKKYRVEVVGMQTGGENGQRINGTPN
SVEPEYYTGAQLVHAGLPVPRLGNEYKSWQVYVKEV
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggggacggattatggcaatcaggatagatcaggatcagaaactgatcacgcta
catacaaaaaatacgacttatcagatggctgtcggtgcttatggacaactgctccatctt
tattatggaccacgtttgggtggtgatatgcggtatcttctgacttattatgacagggga
ttttccggcaatccgtatgaagcagattgtgataagacatattccatggatgcattgccg
caggaatatccctgctttggcaatggagatttccgcagtccggcatttatcctgaaaaat
gcggatggaagttactgtgccgatctgcggtttgtatcctgcgaaatttgtgagggaaaa
tatcggataccgggtcttccggcagcttatgacgagacggggacggagagtgagacttta
aaggtatatctggaggacaagccaagtggcgtgcaggtgacactgctttatggtatattt
gcagagctcgatattattacaagggctgtgcagattacaaaccgggggcaggaggctgtt
catattgaaaaagcagcaagcgctgtacttgattttatgaccggagaatttgatgtgatt
cattttcatggcagacacgggatggagcggatcttagagcgtacgccggtggagcatggc
aatcaggtatttggaagcaggcgcgggtcatccagccatcagcagaatccgtttgtgatg
ctggcgggaaaacagaccggggaagatgccggtgaatgttacggctgtatgcttttgtac
agcggcaattttaaggcggaggcagaaaaagaccagtatgagcagacgaggcttgttatg
ggcttgtccgacgaaatgttctcctggaaattagagccgggagagacgtttgatacaccg
gagacggcatttagttattcggcaaatggtttttcaacactttcgtggaatctgcatcgt
ctgatccgcagccacatctgccgcagtgcataccgcgataccaaaagaccggttctgatc
aataactgggaggcaacttattttgattttaccggagaaaaaatcatagagatcgcaaaa
caggcggcggagcttggcgtggagatgctggtgctcgatgatgggtggtttggaaaacgt
gatgatgatctggcaggactgggcgactggacggtcaatgagaaaaaacttgggatgccg
cttgggaaagttgcagaaaaaattcgtgggcttggcatgaaatttgggatctggatcgag
ccggaaatggtctgtgaggacagtgacctctatcgggaacacccggactgggcatttacc
attcctggacgaaaaccggtgcgtgcacgctatcagcttgtgctcgactattccagaaaa
gaagtggtggacggtatttttgcacagattgcgaaagtgctcgatgacacgaaggctgat
tatgtcaagatggatatgaaccgtcatctcacggatatctggtcgaaaacggcggcagag
cagaatcagggtgcgatcctgcaccgctatgtgctcggtgtttatgattttttggaacgg
ctgcatgaacgttacccggatcttctgattgagggatgcagcggtggcggcggcaggttt
gatgcgggaatgttgtattatacaccacagatctggtgcagtgacaatacggatgcggtt
gagcgtattaaaatacagtatggaacatcctttgcctatccgtcctgcacggtcggttcc
catgtgtcggcagttccgaaccatcagaccggaagaatgacagaacttgcgacacgggca
gcagttgccatggcgggcagttttggttatgaactggacttaaatctgctgacggaagaa
gaaaaggaacaggtcagagagcagatcaaaaactatcaccgttttgagatgctgatccgg
cagggcaggtattacaggctgacagatgtctggcagaaaaaagaatatgctgcgtgggag
tattgcaggccggatggaagcgaggcgctggttactgtggtaacgctggatacgcagtgt
aatccggcgacggagtatgtgaagttgcggggacttggcgaagataaaaagtaccgggtg
gaagttgtcggaatgcagaccggtggcgaaaatgggcagcggatcaatgggacaccgaac
tctgttgagccggagtactatacaggggcacagcttgtgcatgcggggctgccggttccg
cggcttgggaatgagtataagtcgtggcaggtgtacgttaaggaagtgtaa

DBGET integrated database retrieval system