KEGG   Roseburia intestinalis XB6B4: RO1_34770Help
Entry
RO1_34770         CDS       T02597                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:rix00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:rix00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3440761..3441345
Genome map
AA seq 194 aa AA seqDB search
MGKIKVTHDCNGIEGLKVIEPAVFGDARGYFMETYNYNDFKEAGIDCQFVQDNQSASKKG
VLRGLHFQINHPQDKLVRVVSGEVFDVAVDLREGSETFGKWFGIVLTAENKKQFFVPKNF
AHGFIVLSDYAEFCYKVTDFYHPNDEGGILWNDPAIGVEWPMPEGMTRADLILSDKDKVH
GGFDAYCKERGIVR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaataaaggtaacacatgactgtaatggaatcgagggactcaaagtaattgag
ccggcagtcttcggggatgccagaggatatttcatggagacatacaattacaacgatttt
aaagaggcaggaatcgactgccagtttgtacaggataaccagtctgcatcgaaaaaaggt
gtgttaagaggattacatttccagatcaaccacccgcaggacaagctggtgcgtgtggta
agcggagaggtatttgacgttgcagtggatttaagagaaggttctgagacattcggaaaa
tggtttggcatcgttctgactgcggaaaataaaaagcagttttttgtaccaaagaatttt
gcacatggctttatcgtgctgtctgattatgcagagttctgctataaggttactgatttc
taccatccaaatgacgagggcggtattctctggaatgatccggcaatcggtgttgaatgg
ccaatgccggaaggaatgacgagggcggatctgatcctttccgataaggataaagtgcac
ggtggattcgatgcatattgtaaggaacggggaattgtaagatag

DBGET integrated database retrieval system