KEGG   Roseburia intestinalis XB6B4: RO1_39790Help
Entry
RO1_39790         CDS       T02597                                 

Definition
Endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rix00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RO1_39790
Enzymes [BR:rix01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RO1_39790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3948904..3950271
Genome map
AA seq 455 aa AA seqDB search
MKLNKLGKFAALCMAGCMLLGGCGAENPADEKTVTGNAADVSAEKSETRMDSENNTTEKN
DMAAEDTAAETESAETETEDSGVAIPEVVIEPKEIPDTDGMKFVRDMKIGWNLGNTFDAI
TNAQKEDDLSIEWSWCGEKTTKEMIDAVKAAGFKTLRLPVSWHNHVSGDHYTISEAWLDR
VQEVLDYAVDDDMYVILNIHHDTDKEYCYPDKEHLEQSLSYMTFIWEQLADRFGDYDEHV
IFESINEPRLVETDHEWWLDMNAAECVEAVECINEWNQNFVDVVRKTGGNNATRYLMVPG
YDASADGVLNDKFVLPTDTAENEGKILVSVHAYIPYHFALQAATENESIDQFNASEKTST
NDIDQMMEKLYAKYISNEIPVVIGEFGARDKNGNLQSRVDYAAYYIAAARAYGMNCNWWD
NNAFTGDGELFGLLDRKTVTWRYPKIVDALMKYAE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaataagttgggaaagttcgccgcactgtgtatggcaggatgcatgctgctt
ggtggctgtggcgcagaaaatccggcagatgaaaaaacggtgacgggcaatgccgctgat
gtgtcggcagaaaaaagtgagaccaggatggattctgaaaataataccacagaaaaaaat
gatatggcagcagaagatacagcagcggagacagaaagtgcagaaacagaaacggaggat
agtggtgtggcgataccggaagttgtaattgaaccgaaggagatacctgatacagacgga
atgaaatttgtgcgggatatgaagatcggatggaatcttggcaacacatttgatgcaatt
acgaatgcacagaaagaagatgatctcagtattgagtggtcgtggtgcggcgagaagacg
acaaaagaaatgatcgatgcagtaaaggcagcaggtttcaaaacgcttcgcctgccggtg
tcatggcataatcatgtatcgggagatcattacacgatcagtgaggcatggcttgacagg
gtgcaggaagtgttggattatgcggttgatgatgacatgtatgtgattttaaatatccat
catgatacggataaagagtactgttacccggacaaagagcatttagagcagtctctttcc
tacatgactttcatttgggagcagcttgcagaccgttttggagattatgacgagcatgtg
atctttgagagtatcaacgaaccgcgtctggtagagacagatcatgagtggtggctggat
atgaatgctgcggaatgtgtggaagcagtagaatgtatcaacgagtggaatcagaacttt
gtggatgttgtgcgaaagacagggggcaataatgccacacgttatctgatggtgcctggc
tatgatgcctctgcggatggggtgttgaatgacaagtttgtgctgccgacggacactgcg
gaaaatgagggaaagatacttgtctcagtgcatgcttacattccttatcattttgcattg
caggcggcaacggaaaatgagagtattgatcagtttaatgcttctgaaaagacaagtacc
aacgatatcgaccagatgatggaaaaactatatgcgaaatatataagcaatgagatcccg
gtcgtgatcggagagtttggtgcccgggataaaaacggaaatctgcagagccgtgtggac
tatgcggcatactacattgctgcggcgcgcgcttacggcatgaactgtaactggtgggat
aacaatgcgtttaccggggacggcgaactgttcggactgctcgaccggaaaacagttacc
tggagatatccaaagatcgtggatgcactgatgaaatatgcagaataa

DBGET integrated database retrieval system