KEGG   Roseburia intestinalis XB6B4: RO1_39790Help
Entry
RO1_39790         CDS       T02597                                 

Definition
Endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rix00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3948904..3950271
Genome map
AA seq 455 aa AA seqDB search
MKLNKLGKFAALCMAGCMLLGGCGAENPADEKTVTGNAADVSAEKSETRMDSENNTTEKN
DMAAEDTAAETESAETETEDSGVAIPEVVIEPKEIPDTDGMKFVRDMKIGWNLGNTFDAI
TNAQKEDDLSIEWSWCGEKTTKEMIDAVKAAGFKTLRLPVSWHNHVSGDHYTISEAWLDR
VQEVLDYAVDDDMYVILNIHHDTDKEYCYPDKEHLEQSLSYMTFIWEQLADRFGDYDEHV
IFESINEPRLVETDHEWWLDMNAAECVEAVECINEWNQNFVDVVRKTGGNNATRYLMVPG
YDASADGVLNDKFVLPTDTAENEGKILVSVHAYIPYHFALQAATENESIDQFNASEKTST
NDIDQMMEKLYAKYISNEIPVVIGEFGARDKNGNLQSRVDYAAYYIAAARAYGMNCNWWD
NNAFTGDGELFGLLDRKTVTWRYPKIVDALMKYAE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaataagttgggaaagttcgccgcactgtgtatggcaggatgcatgctgctt
ggtggctgtggcgcagaaaatccggcagatgaaaaaacggtgacgggcaatgccgctgat
gtgtcggcagaaaaaagtgagaccaggatggattctgaaaataataccacagaaaaaaat
gatatggcagcagaagatacagcagcggagacagaaagtgcagaaacagaaacggaggat
agtggtgtggcgataccggaagttgtaattgaaccgaaggagatacctgatacagacgga
atgaaatttgtgcgggatatgaagatcggatggaatcttggcaacacatttgatgcaatt
acgaatgcacagaaagaagatgatctcagtattgagtggtcgtggtgcggcgagaagacg
acaaaagaaatgatcgatgcagtaaaggcagcaggtttcaaaacgcttcgcctgccggtg
tcatggcataatcatgtatcgggagatcattacacgatcagtgaggcatggcttgacagg
gtgcaggaagtgttggattatgcggttgatgatgacatgtatgtgattttaaatatccat
catgatacggataaagagtactgttacccggacaaagagcatttagagcagtctctttcc
tacatgactttcatttgggagcagcttgcagaccgttttggagattatgacgagcatgtg
atctttgagagtatcaacgaaccgcgtctggtagagacagatcatgagtggtggctggat
atgaatgctgcggaatgtgtggaagcagtagaatgtatcaacgagtggaatcagaacttt
gtggatgttgtgcgaaagacagggggcaataatgccacacgttatctgatggtgcctggc
tatgatgcctctgcggatggggtgttgaatgacaagtttgtgctgccgacggacactgcg
gaaaatgagggaaagatacttgtctcagtgcatgcttacattccttatcattttgcattg
caggcggcaacggaaaatgagagtattgatcagtttaatgcttctgaaaagacaagtacc
aacgatatcgaccagatgatggaaaaactatatgcgaaatatataagcaatgagatcccg
gtcgtgatcggagagtttggtgcccgggataaaaacggaaatctgcagagccgtgtggac
tatgcggcatactacattgctgcggcgcgcgcttacggcatgaactgtaactggtgggat
aacaatgcgtttaccggggacggcgaactgttcggactgctcgaccggaaaacagttacc
tggagatatccaaagatcgtggatgcactgatgaaatatgcagaataa

DBGET integrated database retrieval system